KEGG   Stenotrophomonas rhizophila: BAY15_1601Help
Entry
BAY15_1601        CDS       T04500                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00020  Citrate cycle (TCA cycle)
srh00190  Oxidative phosphorylation
srh00650  Butanoate metabolism
srh01100  Metabolic pathways
srh01110  Biosynthesis of secondary metabolites
srh01120  Microbial metabolism in diverse environments
srh01130  Biosynthesis of antibiotics
srh01200  Carbon metabolism
Module
srh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
srh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:srh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAY15_1601
   00650 Butanoate metabolism
    BAY15_1601
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAY15_1601
Enzymes [BR:srh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAY15_1601
    1.3.5.4  fumarate reductase (quinol)
     BAY15_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: AOA72035
UniProt: A0A1B2N3H2
LinkDB All DBs
Position
1806052..1806837
Genome map
AA seq 261 aa AA seqDB search
MAEFSLPTNSKIGKGKHFPAKSGAKNTRTFKIYRWSPDDDSNPRTDTYEIDLDACGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTRAIADCGKAEVPIYPLPHM
SVIKDLVPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPEDRKKLDGLYECILCACCST
SCPSYWWNGERYLGPAILLQAYRWIVDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCP
KGLNPALAIAEIKKLMMARRA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttttccctcccaacgaattccaagatcggaaagggcaagcacttccccgcc
aagagcggtgcgaagaacacccgtaccttcaagatctaccgctggagtcccgacgacgac
agcaacccgcggaccgatacgtacgagatcgatctggacgcctgcggcccgatggtcctg
gacgcgctgatcaagatcaagaacgagatcgacccgaccctgaccttccgtcgttcgtgc
cgcgagggcatctgcggttcgtgcgcgatgaacatcgacggcaccaacacgctggcctgc
acccgcgccatcgccgactgcggcaaggccgaagtgccgatctacccgctgccgcacatg
agcgtgatcaaggacctggtaccggacctgactcacttctacgcgcagtacgcctcgatc
aagccgtggatccgcacccagaccccgccgccgccggaccgtgagcgcctgcagtcgccg
gaagaccgcaagaagctggacggcctgtacgagtgcatcctgtgcgcgtgctgctcgacc
agctgcccgagctactggtggaacggcgagcgttacctgggcccggcgatcctgctgcag
gcctaccgttggatcgtcgactcgcgcgacgaagacaccggtgcgcgcctggacgacctg
gaagacccgttcaagctgtaccgctgccacaccatcatgaactgcgcccggacctgcccg
aagggcctgaacccggcgctggcgatcgccgagatcaagaagctcatgatggcgcgccgc
gcctga

DBGET integrated database retrieval system