KEGG   Stenotrophomonas rhizophila: BAY15_2345Help
Entry
BAY15_2345        CDS       T04500                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
srh  Stenotrophomonas rhizophila
Pathway
srh00380  Tryptophan metabolism
srh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BAY15_2345
Enzymes [BR:srh01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BAY15_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AOA72779
UniProt: A0A1B2N5S8
LinkDB All DBs
Position
2680358..2681635
Genome map
AA seq 425 aa AA seqDB search
MSELLSRTHATALDAADPLRALRAEFVFPQHNHRDQTYFVGNSLGLQPRGAKAAVQEVMD
KWGALAVEGHFTGETQWLGYHRLVNRQLAQVVGALPSEVVAMNTLSVNLHLMMVSFYRPS
AERPVILMEAGAFPTDRHAVESQLRFHGFDPATDLVEVQPDEPNGTISLQAIERAITEHG
PRLALVLWPGVQYRSGQVFDLDAITRMARLQGARVGFDLAHSVGNVPLQLHDIAPDFAVW
CHYKYLNSGPGAVAGCFVHERHHRDTSLPRFAGWWGHEEATRFKMAPQFVPAVGAEGWQL
SNPPVLGLAPLRAALDVIDKAGGIQALRDKSLQLTGLLDALVRARLPGVLEVLTPSEPER
RGCQLSLRVLAGRERGRNLFEYLQTVGVLGDWREPDVIRISPTPLYNRYLDLHHFVEEVE
SWAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagctcctcagccgcacccatgccaccgccctggacgccgccgacccgctgcgt
gcgctgcgtgctgaattcgtcttcccccagcacaaccaccgcgaccagacctatttcgtc
ggtaattcgctgggcctgcagccgcgcggggccaaggcggcggtgcaggaggtcatggac
aaatggggtgcgctcgccgtggaaggccatttcaccggcgagacccagtggctgggctac
caccgcctggtcaatcggcagctggcccaggtagtgggcgccctgcccagcgaagtggtc
gccatgaacacgctgagcgtgaacctgcacctgatgatggtcagcttctaccggcccagc
gccgaacgcccggtgatcctgatggaagccggcgccttcccgaccgaccgccacgcggtg
gaatcgcagctccgcttccacggcttcgacccggccaccgacctggtcgaagtccagccg
gatgagcccaacggcaccatctcgctgcaggccatcgaacgcgccatcaccgaacacggg
ccgcgcctggcgctggtgctgtggcccggggtccagtaccgcagcggccaggtattcgac
ctggatgcgatcacccgcatggcccgcctgcagggcgcccgggtcggcttcgacctggcc
cactcggtcggcaacgtgccgctgcagctgcacgacatcgcgccggacttcgccgtgtgg
tgccattacaagtacctcaacagcggccccggtgccgtggccggctgcttcgtgcacgaa
cgccaccaccgcgacaccagcctgccgcgcttcgccggctggtgggggcatgaggaagcc
acccgcttcaagatggctccgcagttcgtgccggcggtgggcgccgaaggctggcagctg
agcaacccgccggtgctgggcctggccccgctgcgggccgcgcttgacgtgatcgacaag
gccggcggcatccaggcccttcgcgacaagtcgctgcagctcaccggcctgctcgatgca
ctggtccgcgcccgcctgcccggcgtgctcgaagtgctcacccccagcgagccggaacgc
cgtggctgccagctgtcgctgcgcgtgctggccggccgtgaacgcggccgcaacctgttc
gaatacctgcagaccgtgggcgtgctgggcgactggcgcgaacccgatgtgatccgtatc
tcgcccaccccgttgtacaaccgctaccttgacctgcaccacttcgtcgaggaagtggaa
tcctgggccggcctgtaa

DBGET integrated database retrieval system