KEGG   Serratia plymuthica 4Rx13: SOD_c00410Help
Entry
SOD_c00410        CDS       T02710                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase SodA
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Brite
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SOD_c00410 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGO53077
UniProt: S0A9H5
LinkDB All DBs
Position
complement(46148..46768)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEALIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPILGLDVWEHAYYLKYQN
KRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccgtacgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacttacgtcaacaacgcgaac
accgtgctggaagcgtaccctgagctggcttcgctgagcgttgaagcgctgatccaggat
ctggataaagtgcctgccgacaagcgcactttcatgcgtaacaacgccggcggccacgct
aaccacagcctgttctggaaaggcctgaaaatcggtaccacgctgggtggcgatctgaaa
gccgctatcgagcgcgatttcggcagcgtcgagaaattccaggaagagttcgagaaagcc
gcagcgacccgcttcggttcaggttgggcctggctggtgctgaaaggcgacaaactggcc
gtggtgtctaccgctaaccaggacagcccgctgatgggcgaagccgttgccggcgcttca
ggcttcccaatcctgggcctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgcccagactacatcaaagcgttctggaacgtggttaactgggacgaagcggcagca
cgcttcgctgcgaagaagtaa

DBGET integrated database retrieval system