KEGG   Serratia plymuthica 4Rx13: SOD_c05040Help
Entry
SOD_c05040        CDS       T02710                                 

Gene name
ampH
Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srl01002]
    SOD_c05040 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srl01011]
    SOD_c05040 (ampH)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SOD_c05040 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SOD_c05040 (ampH)
Peptidases and inhibitors [BR:srl01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   SOD_c05040 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:srl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SOD_c05040 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AGO53514
LinkDB All DBs
Position
complement(550528..551670)
Genome map
AA seq 380 aa AA seqDB search
MKNSFRASLLALSLCAAPLAAQAADPQLASQIVDQYAEHIFFNSGATGMALVVIDNNQVV
NRSFGDTKPGNDLRPRPDSLIRIASITKLMTSEVMVKMAAEGRVKLTDPLRKYAPPGAFV
PAYNSRQPITLLNLATHTSSLPREQPGQKPAKTPVFTWPTKAQRWQWLEHANVTVPPGVR
AAYSNLAYDLLADALSRAANKPYSALLREKITAPLGMVDTTLTPSAEQCSRLMVAAAGPS
ACRDTTAAAGSGGVYSTPRDMQRWMQQFLSSNTAGARKSTAASEQTMYFQRSDLVSLKGM
DVPGEASALGLGWVYMAPKDGLPGIIQKTGGGGGFITYMAMIPQKNIGVFVVVTRSDLTK
FTNMSDPVNRLVGDLAANKS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaactctttccgcgcttcattgctggcgctgagcctgtgcgccgcgccactggcc
gctcaagccgccgacccgcaactggcctcgcaaatcgtcgaccagtatgccgaacacatt
ttcttcaacagcggcgccaccggcatggcgctggtggtgattgataacaatcaggtggtt
aaccgcagctttggcgataccaagccgggcaacgatctgcgcccgcgcccggattcgctg
atccgcatcgcctcgatcaccaagctgatgaccagcgaagtgatggtcaaaatggcggcg
gaaggccgggtcaagctgaccgatccgctgcgaaaatacgccccgccgggcgccttcgtg
ccggcttataattcgcgccaacccattaccctgctgaacctggcgacccacaccagctcg
ctgccgcgcgagcaaccgggtcaaaaaccggcgaaaacgccggtgttcacctggccgacc
aaggcacagcgctggcagtggctcgaacacgccaatgtcacagtgccgccgggcgtgcgc
gccgcctattccaacctggcctatgatctgctggcggatgccttatcgcgagcggcaaac
aaaccttatagcgctctgctgcgcgaaaaaatcaccgcgccgctcggcatggtcgacacc
acccttacccccagcgccgaacagtgttcgcgcctgatggtggcggccgccgggccaagc
gcctgtcgcgataccaccgcagcagccggcagcggcggggtttattccaccccgcgcgac
atgcagcgctggatgcaacagttcctctcttccaacaccgccggcgcacgcaaatcgacg
gcggccagcgaacaaaccatgtacttccagcgcagcgatctggtgtcgctgaaaggcatg
gacgtaccgggtgaagcaagcgcgttgggattgggttgggtgtatatggcaccgaaggac
ggcctgccgggcattattcagaaaaccggcggcggcggtggctttataacctatatggcg
atgatcccgcagaaaaatatcggcgtcttcgtggtggtaacccgctcagatctgactaaa
ttcaccaatatgagcgatccggttaaccggctggtgggggatttggcggccaacaaaagc
tag

DBGET integrated database retrieval system