KEGG   Serratia plymuthica 4Rx13: SOD_c06290Help
Entry
SOD_c06290        CDS       T02710                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00473  D-Alanine metabolism
srl00550  Peptidoglycan biosynthesis
srl01100  Metabolic pathways
srl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SOD_c06290 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SOD_c06290 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SOD_c06290 (ddl)
Enzymes [BR:srl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SOD_c06290 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:srl01011]
 Precursor biosynthesis
  Amino acid ligase
   SOD_c06290 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp RimK ATPgrasp_ST TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AGO53636
UniProt: S0A9U6
LinkDB All DBs
Position
697395..698315
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGTSAEREVSLQSGAAVLAGLREAGIDAHGIDIRDFPVTQLKEHGFTKVFI
ALHGRGGEDGTLQGMLEFLELPYTGSGVMASALTMDKWRTKMVWQSMGLPVAPYVALNRL
QYAGAEKQSLIARVEALGLPLIVKPSREGSSVGMSKVTERDALEAALEEGFRHDDDVLVE
KWLSGPEYTVAMLGDQVLPSIRIQPAGVFYDYQAKYISDDTQYFCPSGLGAEQEAEMAAL
ALRAYRGLDCSGWGRVDVMQDSDGSFYLLEVNTSPGMTSHSLVPMAARQSGLSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagttgccgtactgctgggtggcacctccgccgaacgtgaagtgtcattg
caatccggtgctgccgtgttggcagggctgcgggaagccggtatcgacgcccatggcatc
gatatccgcgatttcccggtaacccagcttaaagagcatgggtttaccaaagtgtttatc
gcgctgcacgggcgcggcggcgaggatggcaccctgcaggggatgctggaattccttgag
ctgccttataccggcagcggcgtgatggcgtcggcgctgaccatggacaagtggcgcacc
aagatggtgtggcagtcgatggggctgccggtcgcgccttatgtggcgcttaaccgtctg
cagtatgccggcgcagagaaacagagcctgattgctcgcgtggaggctctgggcctgccg
ctgatcgtcaagcctagccgcgaaggctccagcgtcggcatgagcaaggtaaccgaacgc
gatgctcttgaagcagcactggaagaaggtttccgccatgacgacgacgtgctggtggag
aagtggctgagtggccctgaatataccgtagcgatgctgggcgaccaggtgttgccttcg
atccgcattcagccggccggcgtgttttacgactatcaggccaagtacatttcggacgat
acccagtatttctgtccaagtggcctgggcgcggaacaagaggccgaaatggccgcactg
gcgttacgcgcctaccgtggactggactgcagcggctggggccgcgtggatgtgatgcag
gatagcgatggcagcttctatctgcttgaggtgaatacctcgccgggcatgaccagtcat
agcctggtgccgatggcagcgcgccagtctggtttaagtttctcgcagctggtagcgaga
attttggagttggccgactga

DBGET integrated database retrieval system