KEGG   Serratia plymuthica 4Rx13: SOD_c06720Help
Entry
SOD_c06720        CDS       T02710                                 

Gene name
mdeA
Definition
(GenBank) methionine gamma-lyase MdeA
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00270  Cysteine and methionine metabolism
srl00450  Selenocompound metabolism
srl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SOD_c06720 (mdeA)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SOD_c06720 (mdeA)
Enzymes [BR:srl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     SOD_c06720 (mdeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 Met_gamma_lyase DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGO53679
LinkDB All DBs
Position
747604..748794
Genome map
AA seq 396 aa AA seqDB search
MSDTIRHAFATRAIHHGYDPQQYLGALCPPVFMSSTFAFPTAEYGGACFAGSEPGYFYSR
IANPTLNLLEQRIANLEGGEAAVAFSSGMGAITACCWTLLAPGDELIVDETIYGCTFSYF
HQGLARFGVKVTHVDLTQPEKLAAAMGPRTRLVYCETPANPNMRLIDIAAVAEITHRQQA
LLLVDNTYCTPYLQRPLALGADIVVHSATKYIGGHGDLLAGLAITREALAQDIRLVGLKD
MNGAVLSAQDAALLLRGLKTLPLRMERHCGNAQRLAEMLAQHPAVEQVYYPGLETFPQYP
LAQRQMTRPGGMIAFELKGGMAAGIRFLNALQLILRAVSLGDCETLAQHPASMTHSAYSA
EERQRHHISDGLIRLSAGLEDIEDLRGDIEQALAQV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacactatccgacacgcctttgccacacgtgcgatccaccacggctacgatcct
cagcaatatctgggggcgctttgcccaccggtctttatgagctcgacctttgcctttccc
acggcagaatacggcggcgcctgctttgccggcagtgagccgggttatttttattcccgc
atcgccaacccgacgctaaatctgctggaacagcggatagccaacctggagggcggggag
gcggcggtggcgttttcttccggcatgggggcgataaccgcttgttgctggacgctgctg
gcgccgggagatgagctgatcgtcgatgaaaccatttatggctgcactttcagctatttt
catcaggggctggcgcggtttggcgtcaaggttacgcacgtcgatctgacgcagccggaa
aaactggccgcagccatggggccacgtacccgcctggtgtactgcgaaacgccggccaac
cccaatatgcggttgatcgatatcgccgcagtggcggagattacccaccggcagcaggcg
ctgctgctggtggataacacgtattgcactccttatttgcaacggccgctggcgcttggt
gcggacatcgtggtgcattccgccaccaaatatatcggtggccacggggatttgctggcc
gggttggcgatcacccgcgaggcgctggcgcaagatattcgcctggtcggtctgaaggac
atgaacggggcggtgctgtcggcgcaggatgcggcgttgctgttgcgcggtttgaagacc
ttgccgttgcgcatggagcgccactgcggtaacgctcaacggctggcggaaatgctggct
cagcatcctgcggtagagcaggtgtattatccggggctggagactttcccgcagtaccct
ttggctcagcggcagatgacgcgtcctggcggcatgatcgcttttgaacttaagggcggt
atggcggcgggcattcgtttcctcaatgccttgcagttaatcttgcgtgccgtcagcctg
ggggattgcgaaacgctggcgcagcatccggcgagcatgacccactcggcctacagcgcg
gaagagcgtcagcgccatcatatcagcgatggattgattcgcttgtcggcgggcctggag
gatatagaggatttgcgtggcgatatcgaacaggcgctggcgcaggtgtga

DBGET integrated database retrieval system