KEGG   Serratia plymuthica 4Rx13: SOD_c25700Help
Entry
SOD_c25700        CDS       T02710                                 

Gene name
yeaD
Definition
(GenBank) glucose-6-phosphate 1-epimerase YeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00010  Glycolysis / Gluconeogenesis
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOD_c25700 (yeaD)
Enzymes [BR:srl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SOD_c25700 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGO55543
UniProt: S0AEE4
LinkDB All DBs
Position
2884546..2885421
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVTEQISPYISQRQLEELPVVVVSHPKVRAAVALQGAHLLAWQPAGDKPVIW
LSNNTPFKKGNAIRGGVPICWPWFGPVAQPSHGFARNQPWNLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHTYFQIGDIEQVKVAGLGEP
YIDKVAGGAEARQTGDLAFIGQTDRVYTQPDAFSLIKDPSLQRTIEVHHHHMSDVIAWNP
GVELSCSMADMANDGYKTMVCVETGRVSKPLVAAGEQPARLAVTFRSRKSA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaattttcaccctgcccgttaccgaacaaatttcaccttacatcagtcaa
cgtcagctcgaagaactgccggtagtggtcgtctcccacccgaaagtccgcgccgctgtt
gcgctgcaaggcgcacacctgttagcctggcaacctgccggtgataagccggttatctgg
ctgagcaacaacaccccctttaaaaaaggcaacgccattcgcggcggtgtgcctatttgc
tggccctggtttggcccggtagcgcaaccctcgcacggtttcgcccgcaatcaaccctgg
aacctgactgcgcacgatgaagacgacaacggtgtcattctgacctttaccctgaaagac
aatgagcaaacccgcaagctttggccgcatgcctttacgctgattgcccgtttcaagctg
ggtgaagaatgcgagattgagctggagtcacacggcgactatcaggctaccgcagcgctg
catacttatttccagattggggatattgaacaagtaaaagtggcgggcctcggcgaacct
tatatcgacaaagtggccggtggagctgaagctcgtcagaccggagacctggcatttatt
ggtcaaaccgatcgggtctatacccaaccggacgctttcagcctgatcaaagatccttct
ctgcaacgcaccattgaggttcatcaccatcatatgagcgatgtgattgcctggaaccca
ggcgtggagctgtcctgcagcatggcagacatggcgaatgacggttataaaaccatggtt
tgcgtggaaaccggccgcgtcagtaaaccactggtggccgcaggtgagcaacctgcacgg
ctggcggtcaccttccgcagccgtaaaagcgcctga

DBGET integrated database retrieval system