KEGG   Serratia plymuthica 4Rx13: SOD_c30090Help
Entry
SOD_c30090        CDS       T02710                                 

Gene name
bcpB
Definition
(GenBank) phosphoenolpyruvate phosphomutase BcpB
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00440  Phosphonate and phosphinate metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    SOD_c30090 (bcpB)
Enzymes [BR:srl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     SOD_c30090 (bcpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL PucR
Motif
Other DBs
NCBI-ProteinID: AGO55979
LinkDB All DBs
Position
3367015..3367884
Genome map
AA seq 289 aa AA seqDB search
MRKTSALKNILQKKELSFLMEAHNAMSAKIAEESGFEALWASGLSISASMGLSDRNEASW
TQVMDVVDFMVDNTAIPILLDGDTGFGNFNNVRRLVKKLSQRGVAGVCLEDKLFPKINSF
IGAGQDLASISEFCGKIQAAKDSQLDSDFCVVARVEALISGCPMEEALKRADAYASAGAD
AVLIHSKQSDGAEIMDFCRQWQNDCPIVIVPTKYYNTATDAFREVGVSTVIWANHSLRAS
IAAMRAITRNIRQHNSVAQIEREIASLDDVFKLTNEYEVQLAEQKYLTL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacatcggctttaaagaatatactgcaaaagaaagaactctctttcctgatg
gaggcccataatgccatgagcgctaaaatagccgaagaaagcggctttgaggcattatgg
gcttccgggctatctatttccgcctctatggggcttagcgacagaaatgaagcgtcctgg
actcaggtgatggacgttgtcgattttatggtggataacaccgccatccctattttatta
gatggggacactggctttggcaactttaataatgtccgccgcttggttaaaaaactgtct
cagcgaggcgtcgccggcgtgtgtctggaagacaaattattccctaaaataaactctttt
attggcgcagggcaggatctggcttccatcagtgaattttgcggcaaaatacaagcggcg
aaagacagccagttggacagcgatttttgcgtggttgcccgtgtggaagcgcttatcagc
ggctgccccatggaagaagcgttgaaacgcgccgacgcctacgccagtgcgggagccgat
gcggtattaattcactccaaacaatctgacggtgcggagatcatggacttttgccgccaa
tggcaaaatgattgcccgatcgttatcgtaccgacgaaatactataacaccgctaccgat
gcgttccgtgaagtcggtgtatccacggttatctgggctaatcatagcctgcgtgcttcc
atcgccgctatgcgcgctattacccgaaatattcgccaacataatagcgttgcacagatt
gaacgtgaaattgcctctttggacgatgtgttcaaactcaccaacgaatatgaagtacaa
ctggccgaacaaaaatacttaaccctttaa

DBGET integrated database retrieval system