KEGG   Serratia plymuthica 4Rx13: SOD_c32920Help
Entry
SOD_c32920        CDS       T02710                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00071  Fatty acid degradation
srl00280  Valine, leucine and isoleucine degradation
srl00281  Geraniol degradation
srl00310  Lysine degradation
srl00362  Benzoate degradation
srl00380  Tryptophan metabolism
srl00410  beta-Alanine metabolism
srl00640  Propanoate metabolism
srl00650  Butanoate metabolism
srl00903  Limonene and pinene degradation
srl00930  Caprolactam degradation
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01200  Carbon metabolism
srl01212  Fatty acid metabolism
Module
srl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SOD_c32920 (fadJ)
   00650 Butanoate metabolism
    SOD_c32920 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SOD_c32920 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SOD_c32920 (fadJ)
   00310 Lysine degradation
    SOD_c32920 (fadJ)
   00380 Tryptophan metabolism
    SOD_c32920 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SOD_c32920 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SOD_c32920 (fadJ)
   00281 Geraniol degradation
    SOD_c32920 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SOD_c32920 (fadJ)
   00930 Caprolactam degradation
    SOD_c32920 (fadJ)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SOD_c32920 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SOD_c32920 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SOD_c32920 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGO56257
LinkDB All DBs
Position
complement(3699193..3701358)
Genome map
AA seq 721 aa AA seqDB search
MSFENALHEQRAKPSAFQLTLRPDNIGVITIDVPGDKVNTLKAEFVEQVNDVLIRAQQHT
ALEGLVIISGKPDSFIAGADITMIAACTSAKEAETLAKKGQSTLAQIAAFPVPVVAAIHG
ACLGGGLELALACHGRVCSLDDKTALGLPEVQLGLLPGSGGTQRLPRLIGASKALDMMLT
GKHIRARQALRMGLVDDAVPQAILLQTAIERVKQGWQSRRELPWQERLLNGPLGKSLLFS
IVRKKTLEKTHGNYPAAEKIIQVVRTGLDSGSTSGYEAEARAFGELAMTPQSAALRSLFF
ASTALKKERGGNAQPHALHRVGILGGGLMGGGIACVTATRGGLPVRIKDVNETGITHALK
YSWDVLGKRVRSKRMRPAERQKQMMLISGSTDYTGFERVDIVVEAVFEDLALKQNMVAEI
EQHAAPHTIFASNTSSLPIGQIAAKAQRPQQVIGLHYFSPVDKMPLVEVIPHATTSEETI
ATTVALAHKQGKTAIVVADRAGFYVNRILAPYINEAARCLLEGEPIESLDKALVDFGFPV
GPITLLDEVGIDVGTKIIPVLVEQLGPRFAAPAAFDAVLKDGRKGRKNGRGFYLYPSEGQ
QRQRGKRADTSVYLLLGITPKSHLQPSVIAQRCVMMMLNEAARCLEEGVIRSARDGDIGA
VFGIGFPPFLGGPFRYMDELGAEKVVKTLQYLQQQYGENFAPCERLQRMAQQGERFYPQG
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgaaaacgcattgcatgaacagcgggccaaaccctcggcttttcaactgacg
ctgcgcccggacaacatcggcgtgattaccatcgacgtcccgggtgacaaggtcaatacg
ctgaaagccgagttcgtcgagcaggttaacgacgtactgatccgcgcgcaacagcatact
gcgctggaagggctggtgattatttcgggcaagccggattcgtttatcgccggggcggac
atcaccatgatcgccgcctgcaccagcgccaaagaggccgaaacgctggcgaagaaaggg
caaagcacgctggcgcagatcgccgctttcccggtgccggtggtggcggctattcacggc
gcttgcctcggtggcgggctggaactggctctggcttgccatggccgcgtttgttcgctg
gatgacaaaaccgctctcggcttgccggaagttcagcttggcctgctgccaggctccggc
ggcacccagcgcttgccacggttgatcggcgccagcaaggcgctggacatgatgctgacc
ggcaagcatatccgtgcgcgtcaggcgctgcggatgggactggttgacgatgcggtgccg
caggcgattttgttgcagaccgccattgaacgggtcaagcagggttggcagagccggcgt
gaactgccgtggcaggagcgcttgctcaacggtcctctggggaaaagcctgttgttcagc
attgtgcgcaaaaaaacgctggagaaaacccacggcaactatccggcggcggaaaaaatc
attcaggtggtgcgtaccggcctggacagcggcagcaccagcggttatgaagccgaagcg
cgggccttcggcgaactggccatgacgccgcagtcggcggcgttgcgcagcctgttcttt
gcctctaccgccttgaagaaagagcgcggcggcaatgcccaaccccatgcgttgcatcgc
gtcggcattctgggcggtggcctgatgggcggcgggattgcctgcgtaaccgccacgcgc
ggcggcctgccggtacgaattaaagacgtgaatgaaaccggcatcactcacgcgctgaaa
tacagctgggatgtgcttggcaagcgggtgcgcagcaaacgcatgcgcccggcggaacgg
caaaaacagatgatgctgatctccggctcgaccgattacaccggctttgaacgggtggat
atcgtggtggaggcggtgtttgaggatctggctctgaagcagaacatggtggccgagatt
gaacagcacgccgcgccgcataccattttcgcctccaatacctcgtcgttgccgattggc
cagattgccgccaaagcgcagcggccgcagcaggtgatcggcctgcattatttcagcccg
gtcgataaaatgccgctggtggaggtgatcccccatgccaccaccagcgaggaaaccatt
gccaccaccgtggcgctggcgcacaaacagggcaagacggccatcgtggtcgccgatcgc
gccggtttttacgtcaaccgcattctggctccttatataaatgaagcggcgcgttgtctg
ctggaaggcgaaccgatcgaatcgctggacaaggcgctggtggatttcggtttcccggtg
gggccgattaccctgcttgatgaagtgggcattgatgtaggcaccaagattatcccggtg
ttggtggaacagctagggccgcgtttcgccgcgccggccgccttcgatgcggtactgaaa
gacgggcgcaaagggcgtaaaaacggccggggtttctacctgtatccgagcgaaggtcag
caacgtcagcggggcaagcgcgccgatacttcggtatatcttctgctgggcatcacgccg
aagtcgcatttgcagccgtcggtcatcgcccagcgctgcgtaatgatgatgttgaatgaa
gcggcgcgttgcctggaagaaggcgtgatccgcagcgcacgcgatggggatatcggcgcg
gtattcggtatcggttttccgccgttcctcggggggccgttccgttatatggatgagctc
ggcgcagagaaggtggttaaaacgctgcaatacctgcagcagcaatacggcgaaaacttt
gccccctgcgaacgcttgcagcgcatggcgcagcagggcgaacgcttttatccgcaaggg
gagtga

DBGET integrated database retrieval system