KEGG   Serratia plymuthica 4Rx13: SOD_c33980Help
Entry
SOD_c33980        CDS       T02710                                 

Gene name
tktA1
Definition
(GenBank) transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00030  Pentose phosphate pathway
srl01100  Metabolic pathways
srl01110  Biosynthesis of secondary metabolites
srl01120  Microbial metabolism in diverse environments
srl01130  Biosynthesis of antibiotics
srl01200  Carbon metabolism
srl01230  Biosynthesis of amino acids
Module
srl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
srl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SOD_c33980 (tktA1)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SOD_c33980 (tktA1)
Enzymes [BR:srl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SOD_c33980 (tktA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AGO56356
LinkDB All DBs
Position
3811006..3812955
Genome map
AA seq 649 aa AA seqDB search
MDAVQKANSGHPGAPMGMADIAEVLWRDYMNHNPTNPHWADRDRFVLSNGHGSMLIYSLL
HLTGYDLPMSELENFRQLHSKTPGHPEYGYTPGVETTTGPLGQGIANAVGFAIAERTLGA
QFNRPGHDIVDHHTYAFMGDGCMMEGISHEVCSLAGTLKLGKLTAFYDDNGISIDGHVEG
WFTDDTAERFEAYGWHVVRHVDGHNPDAIKAAIEEARKVTDKPSLLMCKTVIGFGSPNKA
GTHDVHGAALGAAEVAATREALGWKYAAFEIPQDIYAQWDAREAGQAKESAWNDKFAAYA
KAFPELAAEFTRRVNGELPANWKADAQKFVEQLQANPANIASRKASQNALEAFGKVLPEF
LGGSADLAPSNLTMWSGSKPLNEDLAGNYIHYGVREFGMTAITNGIALHGGFLPYSATFL
MFVEYARNAVRMAALMKIRNVFVYTHDSIGLGEDGPTHQPVEQIASLRVTPNMSTWRPCD
QVESAVAWQYGIERNDGPTTLIFSRQNLTQQPRTAEQLANVYRGGYVLKDCAGTPEVILI
ATGSEVGITVEAADKLSAAGTKVRVVSMPSTDAFDKQDAAYRESVLPSSVTARVAVEAGI
ADYWYKYVGLNGAIVGMTTFGESAPADQLFKEFGFTVDNVVAKAQALLK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtacaaaaagcaaattccggccatccgggcgcacctatgggcatggcggac
atcgccgaagtcctgtggcgcgactacatgaaccacaacccgaccaacccgcactgggct
gaccgcgaccgcttcgtgctgtccaatggccacggctccatgttgatttacagcctgctg
cacctcaccggctacgacctgccgatgagcgagctggaaaacttccgccagctgcattcc
aaaaccccgggccacccggagtacggctacaccccgggcgtcgaaaccaccaccggcccg
ctgggccagggcatcgccaacgccgtcggtttcgccattgccgaacgcaccctgggcgcg
cagttcaaccgcccgggccatgacatcgtcgaccaccacacctacgcctttatgggcgac
ggctgcatgatggaaggcatctcccacgaagtctgttccctggccggtaccctcaagctc
ggcaaactgaccgcgttctacgatgacaacggcatctccatcgacggtcacgtggaaggc
tggttcaccgacgacaccgccgagcgcttcgaagcctacggctggcacgtggtgcgccac
gtcgacggccacaacccggacgccatcaaggcggcgattgaagaagcccgcaaggtcacc
gacaagccgtccctgctgatgtgcaaaaccgtgattggtttcggttccccgaacaaggcc
ggtacccacgacgtgcacggcgctgcgctgggcgccgccgaagtggccgccacccgcgaa
gccctgggctggaaatacgccgcctttgaaatcccgcaggacatctatgcccagtgggac
gccagggaagccggccaggccaaagagtctgcctggaacgacaagttcgccgcctacgcc
aaggccttcccggaactggctgccgaattcacccgccgcgtgaacggcgaactgccggcc
aactggaaagccgacgcgcagaaattcgtcgagcagctgcaggccaacccggccaacatc
gccagccgcaaggcgtcgcaaaacgcgctggaagccttcggcaaggtgctgccggaattc
ctcggcggctcggccgacctggcgccaagcaacctgacgatgtggtccggctccaaaccg
ctcaatgaagacctggcgggcaactacatccactacggcgtgcgcgagttcggcatgacc
gccatcaccaacggcatcgcgctgcacggcggtttcctgccgtactccgcgaccttcctg
atgttcgtggaatacgcccgtaacgcggtgcgcatggcggcgctgatgaaaatccgcaat
gtgttcgtttacacccacgactccatcggtctgggcgaagacggcccgacgcaccagccg
gtcgagcaaatcgccagcctgcgcgtgaccccgaacatgagcacctggcgcccgtgtgac
caggtggaatcggcggttgcctggcagtacggcatcgagcgcaacgacggcccgaccacg
ctgattttctcgcgccagaacctgacgcagcagccacgcaccgccgaacaactggcgaat
gtgtaccgcggcggctacgtgctgaaagactgcgcgggcacgccggaagtgattttgatt
gcgaccggttcggaagtgggcatcacggtggaagcggcagacaagctgagtgccgcgggc
acgaaagtgcgtgtggtgtcgatgccgtcgaccgacgcgttcgacaagcaggatgcggcc
taccgtgaatcggtgctgccgtcttcggttacggcgcgcgtagcggtggaagcgggtatc
gcggattactggtacaagtatgtgggcctgaacggcgccatcgtgggcatgaccaccttt
ggcgagtcggctccggcagaccagctgttcaaagagttcggtttcaccgtggacaacgtg
gtggccaaggcgcaggcgctgctgaagtaa

DBGET integrated database retrieval system