KEGG   Serratia plymuthica 4Rx13: SOD_c41140Help
Entry
SOD_c41140        CDS       T02710                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00250  Alanine, aspartate and glutamate metabolism
srl00410  beta-Alanine metabolism
srl00640  Propanoate metabolism
srl00650  Butanoate metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SOD_c41140 (puuE)
   00650 Butanoate metabolism
    SOD_c41140 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SOD_c41140 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SOD_c41140 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srl01007]
    SOD_c41140 (puuE)
Enzymes [BR:srl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SOD_c41140 (puuE)
Amino acid related enzymes [BR:srl01007]
 Aminotransferase (transaminase)
  Class III
   SOD_c41140 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGO57063
LinkDB All DBs
Position
complement(4649213..4650478)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIERQLKAFTHTAYQIVPYESYVALAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgccaggatgccaccccacgcgggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaacgccacgctgtgggacgtagaaggcaat
gaggttattgatttcgcttccggtattgctgtcctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacggcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtcgcgttggcagagcgcatcaaccagcgcgcaccgattgaaggc
ccttgtaaaaccgccttgttcaccaccggcgcagaagcggtggaaaacgcggtcaaaatc
gcccgtgcctataccggtcggccgggcctgatcaccttcggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggcgccttacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggagcgcatctttaaggcggatatcgatcccaaacaagtggcc
gccatcgtgctggagccggtacagggcgaaggcggtttcaacatcgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcaccatggcgaaaagcctggcgggtggtatgccgctgtcggcggtagccggc
cgtgccgatgtgatggatgccccggcgccgggcgggctgggtggcacctatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgatcgacgaagaacagctgtgc
cagcgttcccaacgtttgggccagcatttggtggaagtactgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggttcaatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgttggaa
gagggcctgctgctgttgagttgcggtgtgaacggcaacgtgatccgcttcctgtatccg
ctgaccatccctgaggaacagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system