KEGG   Serratia plymuthica 4Rx13: SOD_c44400Help
Entry
SOD_c44400        CDS       T02710                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00564  Glycerophospholipid metabolism
srl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SOD_c44400 (glpD)
Enzymes [BR:srl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SOD_c44400 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGO57383
LinkDB All DBs
Position
4988425..4989933
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVEKRGGEVRTRTKVTRAWRENG
LWMVEAVDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWNDEFSIIGTTDVEYHGDPKDVKIDDNEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGDIGGDRDSYAAKLRREHGWLPESLARRYART
YGSHSELILANANGLSDLGEEFGHGLYEAELRYLVEKEWVVELEDAIWRRTKLGMWLDDA
QQARVKAWLAQHTKTKTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcagca
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgcgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgcctggtgagcgaagcgctggccgagcgtgaagtgttgctgaagctggcgccgcac
atcgcgttccccatgcgtttccgcctgccgcaccagccgcatctgcgcccggcctggatg
attcgcatcggtctgttcctgtacgatcacctgggcaaacgcaccagcctgccgggcagc
aagagtttgcgctttggaccagaatcggtactgaagcctgaactgaagcgcggtttcgaa
tattccgactgctgggtcgacgacgctcgtctggtggtgctgaacgcgcaggaagtggaa
aaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgaaaacggc
ctgtggatggtggaagcggttgacgtcgacagcggtaaaacctttacctggcgcgccaag
ggcctggtcaacgccaccggcccttgggtgaaacatttctttgacgacggcctgaagctg
aaatccccgtacggcatccgcctgatcaaaggcagccacattgtggtgccgcgcgctcac
aaccagccgcagtcctatattctgcaaaacgaagaccaccgcatcgtgttcgtgatcccg
tggaatgacgaattctcgatcatcggcaccaccgacgtggaataccacggcgatccgaaa
gacgtgaagatcgacgataacgaaatcgactacctgctgaaagtgtacaacgaccacttc
aagaagcagttgggccgtgacgacatcgtctggacctactccggtgtgcgtccgctgtgc
gatgacgagtccgattcgccacaggcggtgacccgcgactacacgctggacgtgcatgac
gagcagggcaaagcgccgctgctgtcggtgttcggcggtaaactgaccacctatcgcaag
ctggctgaacatgcgatggaaaaactggcgcattactaccctggctgcggcccggcgtgg
accaaaaacggttctctgcccggcggcgacatcggtggcgatcgcgacagctatgccgcc
aaactacgccgcgaacacggctggttgccggaatccctggcgcgccgctacgcccgcacc
tacggcagccacagcgagctgatcctggcgaatgccaacggcctcagcgatctgggcgaa
gagtttggtcacggtttgtatgaagccgaactgcgctacctggtagagaaagagtgggtg
gtcgagttggaagacgccatctggcgccgtaccaaactgggcatgtggctggatgatgca
cagcaggcgcgggtgaaagcctggctggcgcaacacacgaaaacgaaaacgctctctctg
gcttcctga

DBGET integrated database retrieval system