KEGG   Serratia plymuthica 4Rx13: SOD_c45920Help
Entry
SOD_c45920        CDS       T02710                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00620  Pyruvate metabolism
srl00680  Methane metabolism
srl01100  Metabolic pathways
srl01120  Microbial metabolism in diverse environments
srl01200  Carbon metabolism
Module
srl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SOD_c45920 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SOD_c45920 (ppc)
Enzymes [BR:srl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SOD_c45920 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGO57528
UniProt: S0AK55
LinkDB All DBs
Position
5165173..5167809
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDKKLSTKE
LQNAVSQLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYSLPAEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
LAGGDEVQEPYREIMKQLRGQLMRSQAYLEGRLKGERVLKPNDLLVSNDQLWEPLFACYQ
SLQACGMSIIANGQLLDTLRRVRCFGVPLVRIDVRQESNRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVAISSLALYAGAVLEANLLPPPEPKKEWRSLMDDLS
ETSCKMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQNQLEAMCRDWPFFSTRIAMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLESDIKVVLTIANDAHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDTRVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaattgctcggc
gataccatcaaagatgcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgccggtaacgaggcgcatcgtcaggagctgctttccaccttg
cagaacctgtccaacgacgagttgctgccggtcgcgcgcgccttcagccagttccttaat
ctgaccaacgtcgccgagcagtaccacagcatttcgcccaatggcgaagccgccagcaat
cccgaagcgctggcccagttgttcacccggctgaaagacaaaaagctcagcaccaaagag
ctgcaaaatgcggtctctcagctctccatcgagctggtgctgacggcgcacccgacggaa
atcacccgccgcaccctgatccacaagctggttgaggtcaatacctgtctgagccaactc
gatcataacgatctggccgattacgagcgcaacaagatcatgcgccgcctgcgccagctg
gttgcccagtcatggcacaccgacgagatccgtaaaaaccgcccttcgcctatcgacgaa
gccaagtggggctttgcggtggtggaaaacagcctgtgggaaggggtgcctgccttcctg
cgcgaattcaacgagcagttggaaaactccatcgattacagcctgccggcggaagccgtg
ccggtgcgtttcacctcctggatgggcggtgaccgcgacggtaacccgaacgtgaccgcc
gaaatcacccgtcacgtgctgctgctcagccgctggaaagcctgcgacctgttcacccgc
gatatccaggtgttggtgtccgagctgtcgatgaccgaatgtactccggaattgcgcgcc
ctcgccggtggcgacgaagtgcaggaaccgtaccgcgaaatcatgaaacagctgcgcggc
cagttgatgcgctctcaggcctatctggaaggccgcctgaaaggcgaacgcgtgctgaaa
ccgaacgacctgctggtaagcaacgatcagctgtgggaaccgttgttcgcctgttatcag
tcgctgcaggcctgcggcatgagcatcattgccaacggtcagttgctggataccctgcgc
cgcgttcgctgctttggcgtgccgctggtgcgtatcgacgtccgtcaggaaagcaaccgc
cataccgaagccatcgccgaactgacccgttatctgggcctcggcgactacgaaagctgg
tcagaagccgacaaacaagcattcctgatccgcgaactgaactccaaacgcccgctggtg
ccgctgaagtgggaaccgagcgccgatacccaggaagtgctggaaacctgccgcgtgatc
gccgaagcgccgcaaggctccatcgccgcctacgtcatctccatggcacgcaccccttcc
gacgtgctggcggtccatctgctgctgaaagaagccggttgcccgtttgcactgccggtc
gcgccgctgttcgaaaccctcgacgacctgaacaacgccgacgacgttatgacccagttg
ctgaatatcgactggtatcgcggctttatccagggcaagcagatggtgatgatcggctat
tccgactcggcgaaagacgccggggtgatggccgcttcctgggcgcagtaccgcgcgcaa
gatgccttgatcaaaacctgtgaaaaggccggcgtggcgttaacgctgttccacggccgt
ggcggttcgattggtcgcggcggcgcgcctgcgcatgcggcgctgctgtcgcagcctccg
ggcagcctgaaaggtggcctgcgcgtgaccgagcagggtgagatgattcgcttcaaattt
ggcctgccggaagtggccatcagcagcctggcgctgtatgccggcgcggttctggaagcc
aacctgttgccgccgccggagccgaagaaagagtggcgttcgctgatggacgacctgtcg
gagacatcgtgcaaaatgtaccgcggctacgtgcgcgagaatccggacttcgtgccttac
ttccgcgccgcaacgccggaactggaactgggtaaactgccgctgggttcacgcccggcc
aagcgcaagccaaacggcggcgtagaaagcctgcgcgccattccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccggcctggctgggcgccggcgcaggtttgcaggaagcg
gtgaaagccggcaaacagaatcagttggaggccatgtgccgcgactggccgttcttctct
acccgcatcgccatgctggaaatggtcttcgccaaggccgacctgtggctggcggaatat
tacgatcagcgcctggtcgacaaatcgctgtggccgctgggccagcagctgcgcgatcag
ctcgaaagcgacatcaaggtcgtgttgaccatcgccaatgacgctcacctgatggaggat
ctgccgtggatcgccgaatccatcgcgctgcgcaacgtgtataccgatccgctgaacgtg
ctgcaggcagaactgctgcaccgctcgcgccagcaggaacatcctgatacccgcgtcgaa
caggcattgatggtcaccattgccggcgtcgccgccggcatgcgcaacaccggctag

DBGET integrated database retrieval system