KEGG   Salinibacter ruber M8: SRM_00615Help
Entry
SRM_00615         CDS       T01209                                 

Gene name
fab1
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
srm  Salinibacter ruber M8
Pathway
srm00061  Fatty acid biosynthesis
srm00780  Biotin metabolism
srm01100  Metabolic pathways
srm01130  Biosynthesis of antibiotics
srm01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:srm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SRM_00615 (fab1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SRM_00615 (fab1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SRM_00615 (fab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:srm01004]
    SRM_00615 (fab1)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SRM_00615 (fab1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SRM_00615 (fab1)
Lipid biosynthesis proteins [BR:srm01004]
 Fatty acid synthase
  Component type
   SRM_00615 (fab1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CBH23536
UniProt: D5H681
LinkDB All DBs
Position
746748..747584
Genome map
AA seq 278 aa AA seqDB search
MDGYDLLDGKTGVIFGALNEDSIAWSVAQACHREGADFVLSNAPVARRLGSLDALAEETD
SPIIWADATDDEELAALFEEVKDEYGSIDFIVHSIGMGVNVRKDVPYEDLNYNWYEQTLD
VSAVSLHRIVNHALDTEAIDDGGSILAMSYIGAERIFSKYSEMGDAKALLESIVRSFGYR
LGERNIRINAISQSPTKTTAGSGIDGFDAMYEFAERVAPLGNADADSCADYAVTLLSDLT
RMVTMQTLYHDGGFSTMGISDEIVEAMEDAFAEDEEDE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggacggttacgacctgctcgacggaaagacgggcgtcatctttggggccctcaatgag
gacagcatcgcctggtcggttgctcaggcctgtcaccgcgagggggcggactttgtcctc
tccaacgccccggtggcccgccgcctcggctccctcgacgcgctggcggaggagacggac
agccccatcatctgggccgacgccaccgacgacgaggagctcgccgcgctcttcgaagag
gtcaaggacgagtacggctcgatcgacttcatcgtccactccatcgggatgggcgtcaac
gtgcgtaaggacgtgccctacgaggacctcaactacaactggtacgagcagacgctcgac
gtgtcggccgtgagcctgcaccgcatcgtgaaccacgccctcgacaccgaggcgatcgac
gacggcgggtcgatcctggcgatgagctacatcggcgccgagcgcatcttctcgaagtac
tcggagatgggcgacgccaaggcgctgctggaaagcatcgtgcgctccttcggctaccgg
ctgggcgagcgcaacatccgcatcaacgccatctcccagagccccacgaagacgaccgcc
ggctccgggatcgacggcttcgacgcgatgtacgagtttgccgagcgcgtcgcccccctc
ggcaacgccgacgccgacagctgcgccgactacgccgtgacgctcctcagcgacctcacg
cgcatggtgaccatgcagacgctctaccacgacggcggcttctccaccatgggcatctcc
gacgaaatcgtggaggcgatggaggatgcctttgcggaggacgaggaggacgagtag

DBGET integrated database retrieval system