KEGG   Salinibacter ruber M8: SRM_00663Help
Entry
SRM_00663         CDS       T01209                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
srm00473  D-Alanine metabolism
srm01100  Metabolic pathways
srm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SRM_00663 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SRM_00663 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srm01011]
    SRM_00663 (alr)
Enzymes [BR:srm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SRM_00663 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:srm01011]
 Precursor biosynthesis
  Racemase
   SRM_00663 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBH23584
UniProt: D5H6C9
LinkDB All DBs
Position
808594..809991
Genome map
AA seq 465 aa AA seqDB search
MPVDSTGRGPVGCEAGGRGEHVRRAIGAGSFGNHRPGRRLSCACSLIFARSPVPFAIDRS
PHTVGAAPVTATVDLAAIQHNAGVLQERAGGADVMAIIKADAYGHGVRPVARAAYEAGIR
HYGVARLPEGVHLREAGHGGRILVLGAPAPTQLPRYAEYDLDLTVPSADIAAAVVRHASP
EAPLRVHVTVDTGMGRLGLAPDDVPAVMTRLADAPGVRLAGLWTHFATADAPGSSFAQTQ
LDRFRAVVDAVDVDVEHVHAANTGGLLTIGAPTHEFDASLVRSGIALYGLAATPELSARL
DLRPAMRLAARVTHLKTVPAGTPISYGAQWEAPRRTRIATLGIGYGDGYPRRCSGRASVR
IGGASCPIVGTICMDMCMVDLGPPNEAPATRVDRGDEAVLFGPAGPTAYDVAQWSDTIPY
EILCGVSPRVPRRHVNCTDENGTDENGTDDMRAPSRLTRPTASGG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgactcaactggtcgaggccctgtgggttgcgaggccggcgggcgcggcgaa
cacgtccgtcgggccatcggggctgggagctttgggaaccatcgtccgggtaggcgccta
tcatgcgcctgctcactcattttcgcgcgcagccctgtcccttttgccatcgatcggtcg
cctcacacagtcggagccgcgccggtgaccgccaccgtagacctggcggccattcagcac
aacgcaggcgttctgcaggagcgggccggtggggccgacgtgatggccatcatcaaggcc
gacgcgtacggacacggcgtgcgcccggtggcccgggcggcctacgaggcggggattcgt
cactacggcgtggcccggctgccggagggcgtgcacctgcgggaggccggacacgggggg
cgcattcttgtccttggggccccggcccccacgcagctgccgcggtacgccgaatacgac
ctcgacctcaccgtcccttcggccgacattgcggccgcggtcgtgcgacacgcgtcgccg
gaggccccgctccgggtccacgtgacggtcgacacgggcatggggcgtctggggctggcc
cccgacgacgtgccggcggtgatgacgcgcctggccgacgcccccggcgtccgcctcgcc
gggctgtggacccacttcgcgacggccgacgcccccggaagttcgtttgcacagacccaa
ctcgatcgctttcgggcggtcgtcgacgcggtcgacgtggacgtcgagcacgtgcacgcg
gccaacacgggagggctcctcaccatcggggcgcccacccacgaattcgacgcgtccctt
gtccggagcggcattgcgctgtacggcctggcggcgaccccggagctgagcgcccgcctc
gacctgcgtccggcgatgcggcttgcggcccgggtcacccacctcaagacggtcccggcc
ggcacgccgatctcctacggggcgcagtgggaggccccgcgccggacccgcatcgcgacg
ctaggcatcgggtacggcgacggctacccgcgccggtgctccggccgcgcctcggtgcgg
attgggggcgcctcgtgtcccatcgtgggcaccatctgcatggacatgtgtatggttgat
cttgggcctccaaacgaggccccggccacgcgggtcgaccggggcgacgaggccgtcttg
ttcggccccgccgggcccaccgcgtacgacgtggcccagtggagcgataccatcccctac
gagattctgtgcggggtgtccccccgtgtgccccgacggcacgtaaattgcaccgacgaa
aacggtaccgacgaaaacggtaccgacgacatgcgggctccgtcccgtctgacacggccc
accgcgtcggggggctga

DBGET integrated database retrieval system