KEGG   Salinibacter ruber M8: SRM_01068Help
Entry
SRM_01068         CDS       T01209                                 

Definition
(GenBank) Conserved hypothetical protein containing TPR-repeat
Organism
srm  Salinibacter ruber M8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_12 TPR_16 TPR_1 TPR_11 TPR_19
Motif
Other DBs
NCBI-ProteinID: CBH23989
UniProt: D5H7I4
LinkDB All DBs
Position
complement(1219721..1222102)
Genome map
AA seq 793 aa AA seqDB search
MLNPDRPQRYRQTSRHSGPDRRCTHRRPPGNGRHGGDWGRPCGCPVLFFFYASADAPPPP
QIDAARPRRTDCARQAQAGAHRARLDEGVPVGPAPAPLSGPERRGRGRRQVQARRGGDGP
AAGAAAVLGRGRGRGPGQDRAPRDRLPRHAPRLQQVGPVPGRGAGSRGPGRPNGRPDGPD
RPLPGPRRRRRAVRGREGPDCRLARRPDMGPGGPRRRIEPAPTVRRATRPLEPLRRADVG
SACIIFLPFAARAMRRLARSAALFLAFGLLAGPALAQPAEYGTTEFANSGAEAAQEPFLR
GLLMLHSFEYDDARAAFQEAQAIDPDFAMAHWGEAMTHNHPIWMEQDRKAALQALRDLAP
TPDAQLDAAATEREAAYLRTLHVLYGAGNEAPMDKEARDDAYEDAMADLAAQYPDDLDAQ
AFHALSILGTAHEGRDFATYMRAASIVEEVFDANPQHPGAAHYLIHAYDDPVHAPLGLRP
ARVYADIAPAAPHALHMPSHIFFALGQWARGASSNVDSYRAAKNKSTAADEGLSGGGFHA
LHWLHYARLQQGRYADARAILDTTRTHATDSRVQTGYADYMRWYMPVAYVVETEHWDRYD
ALAEAMAVDAAALDARGAVTLHAGRGLAAAQQGTLSAARSALEKAQSALGEDPSEALRIQ
VLELEGLIALKAGDDEQALSHLKEATALETDRPLNFGPLFPAKPAPELYGEALLALDRPA
DALTQFETTLERYPARARSLWGKARAAARADRPEAAQAARSALASQWQGADASVRRQLQS
LAGSAEAETAQSR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccccgatcgaccgcagcggtaccgccaaacgtctcggcactccggtccggac
cgacgttgcacccatcgacggcccccgggcaacggccggcacggcggcgattggggccgg
ccctgtgggtgcccggtgctctttttcttctacgcctctgccgatgcgccacctccgccg
caaattgacgctgcgcgcccacgacgaacagattgtgctcgtcaagcgcaagcaggagcg
catcgagcacgtctggatgaaggcgttcctgtgggccctgcacctgccccactatccggg
cctgaacgtcgaggtcgcggtcgacgacaagtacaagcccgacgtggtggcgatggaccg
gcggcgggggcggccgcagttttggggcgaggccggggccgtgggcccggacaagaccga
gcacctcgtgaccgcctaccccgacacgcacctcgccttcagcaagtgggaccggtccct
ggacgcggtgcgggatcccgtggaccgggccgcccaaacggccgaccggacggccccgat
cgacctcttccgggtccccgccgacggcgccgagcggttcgtggacgcgaagggccggat
tgccgtctcgcgcgacgacctgacatgggtccgggtgggccccgccgacggatagagccc
gctcctaccgtccggcgcgccactcgccccctcgaacctttgcggagggcggatgtaggc
agtgcatgcatcatttttctccctttcgccgcccgtgcgatgcgccgtctcgcccgcagt
gccgccctctttctcgccttcggcctcctcgccggtccggcccttgcccagccggccgag
tacggaaccactgagtttgccaactcgggcgccgaggcggcccaggagccgttcctgcgc
ggcctcctgatgctccacagcttcgagtacgacgacgcccgcgcggccttccaggaggcg
caggcaatcgaccccgacttcgccatggcgcactggggcgaggcgatgacgcacaaccat
ccgatctggatggagcaggaccgcaaggcggcgctccaggccctccgcgacctggccccc
acgcccgatgcccagctggacgcggccgccaccgagcgcgaggcggcctacctccgcacg
ctgcacgtgctctacggcgccgggaacgaggccccgatggacaaagaggcccgcgacgac
gcctacgaggacgcaatggcggacctcgccgcgcagtaccccgacgacctcgatgcgcag
gccttccacgccctgtccatcctgggcaccgcccacgaggggcgcgacttcgctacgtac
atgcgcgccgcgtcgatcgtggaggaggtgttcgacgcaaacccgcagcaccccggggcg
gcccactacctgatccacgcctacgacgacccggtgcacgccccgctcggcctgcgcccc
gcccgcgtgtacgccgacattgctccggcggccccccacgccctgcacatgccgtcccac
atcttcttcgccctcgggcagtgggcccgcggcgcctcgtcgaacgtcgactcgtaccgg
gcggcaaaaaacaagagcacggcggccgatgagggcctgagcggcggcggctttcacgcc
ctgcactggctccactacgcgcgcctccagcagggccgctacgcggacgcccgggccatc
ctcgacacgacccggacgcacgccaccgactcgcgggtgcaaaccggctacgcggactac
atgcgctggtacatgccggtcgcctacgtcgtggagacggagcactgggaccggtacgac
gccctcgccgaggcgatggccgtggacgccgctgccctcgacgcgcggggcgccgtcacc
ctgcacgcgggccggggcctcgccgccgcgcagcagggcactctgtcggccgcccgctcg
gcgttggagaaggcccagtcggccctgggcgaggacccgtcggaggcgcttcggattcag
gtgctcgagctggaggggctgatcgcgctaaaggccggcgacgacgaacaggccctctcg
cacctcaaggaggccacggccctcgaaacggaccggccgctgaacttcgggccgctcttc
cccgcgaagcccgcccccgagctgtacggcgaggcgctcctcgcgctcgaccggccggcc
gacgccctcacgcagtttgagacgacgctggagcggtatccggcccgggcccgctcgctt
tggggcaaggcccgtgcggccgcccgggccgatcggccggaggcggctcaggcagcccga
tcggccctcgcctcgcagtggcagggcgccgacgcctccgtccggcgccagctccagtcg
ctcgccggctcggccgaggcagagacggcgcagtccaggtag

DBGET integrated database retrieval system