KEGG   Salinibacter ruber M8: SRM_01079Help
Entry
SRM_01079         CDS       T01209                                 

Gene name
smc
Definition
(GenBank) Chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
srm  Salinibacter ruber M8
Brite
KEGG Orthology (KO) [BR:srm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srm03036]
    SRM_01079 (smc)
Chromosome and associated proteins [BR:srm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SRM_01079 (smc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_15 AAA_21 AAA_29 ZapB ABC_tran DUF3584
Motif
Other DBs
NCBI-ProteinID: CBH24000
UniProt: D5H7J5
LinkDB All DBs
Position
1234028..1237588
Genome map
AA seq 1186 aa AA seqDB search
MYLSKLELQGFKSFADETTLTFDPGVTTIVGPNGCGKSNIVDAIRWVIGEQRPTVLRSEK
MENLIFNGTADRRPLGMAEVELTIENTDGVLPTEYAEVTIGRRLFRDGTSEYLMNGTTCR
LKDITDLFMDTGMAADAYSVIELKMVDELVSGSTEDRRRMFEEAAGITRYKMRRRQALRK
LDGTQSDLERIRDLTDEVSTQVERLERQAEKAQRYQEAEAELRRLELLLAQVEFNRLAER
QDALQQKETEHAERAAARAEDEEATEARLQELRETLATREATLQERREALQEHRARVREL
EAEQRLQRERLTRARNDRDEAQQAQEEARERRRALTDEVERLESALEQARPALDDAEAAL
DDAREERDAAKAAATDRREDVRERREAAEAAEAEHAEQRRALDQRTNRQELLEDERTRAR
TQYDDLAETIDGLDARIDEAEADRAAAQEALEEARSARAEAATERDERRAALEAAQDELR
ELERRRDAAEAEVELLEGLVGSYDEVSDAVQFLAAEELFDDLYTVADVLGCDDDVRVALD
AALGALASCVVVPTVDDARAAVARLRDAEKGQTSFLVLDRLPDAPPSVSAPEGAVPLRDV
VRTTDPAYAPLADTLLRDCFLVDTLAAAEALAEQTQDAARSVRVFARTGEWVDSTGVLRG
GSRQEDVSPAASRLGRREQLARAREQLGDLQAACEEQDEDVAEAEAALNEIDLAGHESAV
QEAEATLADAEQRLERLRYERTSTEERRAELQERLDEIEEELTEHEERVHELREAVEAAE
EEMQRRRQERAEAEEALAEAEERERAAVDAFSEVQVAAVEARNRVDNLEQDLERTRDQID
EIDRQTGERTAKIEDLEATIEAALDEQTELDEQIEALREEREDRDESVETAEAALQETKA
EIEEVESRLRSIRQEREAALEQKNEAAVALTKVETRTQDLLDSMAADFDRDLADDPVSVP
EAFDESEAQSEVKSLRGTINALGDVNPLALEEYEDEKERLDFLREQKTDLEEAEDTLLDT
IQEINTKASERFMETFDEIKESFGTIFTELFGEGASAELQLEDPDDPIDSAIEIVAKPRG
KRPVTLDQLSSGEKALTATALLFSIYLVKPSPFCVLDEVDAPLDDANVERFMNLVRRFED
DTQFVLVTHNQRTMDLSDRMYGVTMEEQGVSTLVGVEFDEAAELTE
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgtacctcagcaaactcgaactgcagggcttcaagagctttgcggatgagaccacgctc
acgttcgaccccggcgtgaccaccatcgtcgggccgaacgggtgcggcaagtcgaacatc
gtcgacgccatccgctgggtcatcggcgagcagcgtcccaccgtgctccggtcggagaag
atggagaacctcatctttaacggcacggccgaccggcgcccgctcggcatggcggaggtg
gagctgacgatcgaaaacaccgacggggtgctgcccacggagtacgccgaagtcacgatc
ggccgccgcctcttccgcgacggcacgtccgagtacctgatgaacgggaccacgtgccgc
ctcaaagacatcacggacctgttcatggacaccgggatggcggcggacgcctactcggtg
atcgagctgaagatggtcgacgaactggtgtccggctccaccgaggaccgccggcgcatg
tttgaggaggcggccggcatcacacgctacaagatgcgccggcgccaggccctccgcaag
ctcgacggcacgcagtcggacctggagcgcatccgcgacctgaccgacgaggtgagcacg
caggtggagcgcctggagcggcaggccgagaaggcgcagcggtaccaagaggcggaggcg
gagctgcggcgcctggagctgctgctcgcgcaggtggagttcaaccggcttgcggagcgc
caggacgcgcttcagcagaaggagacggagcacgccgagcgggccgcggcgcgggccgag
gacgaggaggcgaccgaggcccgccttcaggagctgcgggagacgctcgcgacccgggag
gccaccctccaggagcgtcgggaggcgctccaggagcatcgggcgcgcgtccgggagttg
gaggcggagcagcggctgcagcgggagcgtctcacccgggcccgcaacgaccgcgacgag
gcgcaacaggcccaagaggaggcccgcgagcggcgtagggccctgaccgacgaggtggag
cgcctggagagcgccctggagcaggcccgtcccgccctcgacgacgccgaggccgccctc
gatgacgcccgcgaggagcgggacgcggcgaaggcggccgcaaccgaccgccgtgaagac
gttcgggagcgccgcgaggccgccgaggcggcggaggccgagcacgccgagcagcgccgg
gcgctcgaccagcgcacgaaccggcaggagcttctggaggacgagcggacgcgtgcccgc
acccagtacgacgacctggcggagaccatcgacgggctcgacgcgcgcatcgacgaggcg
gaggcggaccgcgccgccgcccaggaggcgctcgaggaggcccgctcggcccgggcggag
gccgccacggagcgcgacgagcggcgggccgccctggaagcggcgcaggacgagcttcgg
gagctggaacgccgccgggacgccgccgaggcggaagtcgaactcctcgagggcctcgtc
ggcagctacgacgaggtttcggatgccgtgcagttcctggccgccgaggagctgttcgac
gacctctacaccgtggccgacgtgctcgggtgcgacgacgacgtccgcgtggcgctcgac
gcagccctgggcgccctcgcgtcctgcgtggtcgtgcccaccgtcgacgacgcccgggct
gccgtggcccggctgcgcgacgccgagaagggacagacctcgttcctcgtgctcgaccgc
cttcccgacgcgccgccgtccgtgtcggcgcccgagggcgcggtgcccctccgagacgtc
gtccgcacgacggacccggcgtacgcgcccctggccgacacgctgctgcgtgattgcttc
ctcgtcgacacgctggcggcggcggaggccctcgccgagcagacgcaggacgcggcccgg
tcggtgcgggtgtttgcccgcacgggcgagtgggtcgactcgaccggtgtccttcggggg
gggagccggcaggaggacgtgtcgccggccgcgagtcgcctggggcgccgcgagcagttg
gcccgcgcccgcgagcaactgggcgacctgcaggcggcctgcgaggagcaggacgaagac
gtggcggaggcggaggccgccctcaacgagatcgacctcgcgggccacgagtctgcggta
caggaggccgaggcgaccctcgccgacgccgagcagcgcctggaacggctccgctacgag
cgaacgtcgaccgaggagcggcgcgccgagctgcaggagcgcctcgacgagattgaggag
gagctcaccgagcacgaggagcgcgtccacgagctgcgggaggcggtggaggccgccgag
gaagagatgcagcgccggcgccaggagcgcgccgaggcggaggaggccctcgccgaggcg
gaggagcgcgagcgggcggccgtcgacgccttcagcgaggtgcaggtggcggccgtcgag
gcccggaaccgggtggacaacctggagcaggacctggagcggacccgcgaccagatcgac
gagatcgaccgacagaccggcgagcgcacggccaaaatcgaggacctggaggcgaccatc
gaggcggccctcgacgagcagacggagctggacgaacagatcgaggcccttcgcgaggag
cgcgaggaccgggacgagtccgtggagacggccgaagcggcgctccaggagacgaaggca
gagatcgaggaagtggagtctcgcctccggtcgatccggcaggagcgcgaggcggccctg
gagcagaaaaacgaggccgccgtggccctgacaaaggtggaaacccgcacccaggacctg
ctcgacagcatggcggcggacttcgaccgggacctggcggacgacccggtgtcggtgccc
gaggcgttcgacgagagcgaggcgcagtccgaggtcaagagcctgcgcgggacgatcaac
gccctgggcgacgtgaatcccctcgcgcttgaggagtacgaggacgaaaaggagcgcctc
gactttctgcgggagcagaagacggacctggaggaggcggaggacacgctcctcgacacc
attcaggagatcaacacgaaggcctcggagcgcttcatggagaccttcgacgagatcaag
gagagcttcggcaccatcttcaccgagctgttcggggagggtgcctccgcggagctgcag
ctcgaggacccggacgaccccatcgactcggcgatcgagatcgtggccaagccgcggggc
aagcggcccgttacgctcgaccagctgtccagcggcgagaaggccctgacggctaccgcg
ctgctcttttccatctacctcgtgaagccgagccccttctgcgtcctcgacgaggtggac
gcgccgctcgacgacgccaacgtggagcgcttcatgaacctcgtccgtcgcttcgaggac
gacacccagttcgtgctcgtgacccacaaccagcgcacgatggacctctcggaccgcatg
tacggggtgacgatggaggagcagggcgtgtcgacgctcgtgggggtggagttcgacgag
gccgcggagctgaccgagtag

DBGET integrated database retrieval system