KEGG   Salinibacter ruber M8: SRM_01656Help
Entry
SRM_01656         CDS       T01209                                 

Gene name
glpA
Definition
(GenBank) FAD-dependent glycerol-3-phosphate dehydrogenase subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srm  Salinibacter ruber M8
Pathway
srm00564  Glycerophospholipid metabolism
srm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SRM_01656 (glpA)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SRM_01656 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 GIDA Pyr_redox_3 HI0933_like FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CBH24577
UniProt: D5H972
LinkDB All DBs
Position
complement(1887585..1889159)
Genome map
AA seq 524 aa AA seqDB search
MNRTQGIEALQSRQTPWDFVIIGGGATGLGCAVDAAARGYDTLLLEMHDFAKATSSRSTK
LVHGGVRYLEQGNVSLVFEALKERERLQDNAPHLVSNLPFVVPSYKWWEAPYYGIGMKVY
DLLAGSQNFGRSQYLDRNQTIERLPTVETNGLRGGILYFDGQFDDTRLAVNMAQTADEQG
GVLLNYMKATDLKKTNGAVDGVVAECQETGATFDIEARSVINATGIFTDTIRQMDDPSAG
TTLRPSRGTHIVLDKSFLPGDSAIMVPKTDDGRVLFAIPWHDRVVVGTTEAEVDEVSMEP
TPGHEELDFLLTHAQRYLAKDPGPEDVRSVYAGIRPLVAPPGSNGDTSDISREHQLNVSD
SGLVTISGGKWTTYRKMAEDTIDRAARHAELARRPSQTDDLRLHGWHQNPEQFGDLALYG
ADAEALGGLMEEHPHLQNPLDERLPIRAGQVVWAARHEMARTVEDVLARRTRCLLLDAQA
SIDVAPRVAELMAEERDLPPSWVDDQVEAFTEVARNYLMPSIPA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcacacaaggtatcgaggcacttcaatcccgccagacgccctgggatttcgtc
atcattggcggcggggccaccgggctcggctgtgccgtggacgccgcggcacggggctac
gatacgctcctgcttgagatgcatgacttcgcgaaggcgacttccagccgctcgacgaag
ctcgtgcacggcggcgtccggtacctggagcagggcaacgtgtccctcgtcttcgaggcg
ctgaaggaacgggagcggcttcaggacaacgccccccacctcgtgagcaacctccccttc
gtggtcccgagctacaaatggtgggaggccccctactacgggatcgggatgaaggtgtac
gacctgctcgcgggcagtcaaaactttggccggtcgcagtacctcgatcgaaaccagacg
attgagcgccttcccaccgtggagaccaacggcctgcgcggcggcattctgtactttgac
gggcagttcgacgacacccggctggccgtcaacatggcccagacggccgacgagcagggc
ggcgtgctgctcaactacatgaaggcgacggacctcaaaaagacgaatggggccgtggac
ggcgtggtcgccgagtgccaggaaaccggcgccacgttcgacatcgaggcccggtcggtg
atcaacgccaccggcatcttcaccgacaccatccgccagatggacgacccgtcggccggc
accacgctgcgccccagccgcgggacccacatcgtcctggacaagtcgttcctgccgggc
gacagcgcgatcatggtgccgaaaacggacgacggccgcgtcctcttcgccatcccgtgg
cacgaccgggttgtcgtcggcacgaccgaggcggaggtcgacgaggtgagcatggagccc
acacccgggcacgaggagctggacttcctcctcacccacgctcagcggtacctcgcgaag
gacccgggcccggaggatgtgcgaagcgtgtatgccggcattcgtcccctggtggccccc
cctggaagcaacggggacacctcggacatctcccgcgagcaccagctcaacgtgtccgac
agcggcctcgtcaccatttcggggggcaagtggaccacctaccgcaagatggcggaagac
accatcgaccgggcggcccgccacgcagagcttgcccgccggccgtcccaaacggacgac
ctccgcctgcacggctggcaccaaaacccggagcagtttggcgacctcgccctctacggc
gccgatgccgaagcgctgggcggactgatggaggagcacccccacctccagaaccctctc
gacgagcggcttcccatccgggccggacaggtggtgtgggccgcccggcatgagatggcc
cgtacggtagaggacgtcctggcccgccgcacccgatgcctgctgctcgacgcccaggcg
agcatcgacgtggcgccccgggtcgccgagttgatggccgaagaacgggacctgcccccc
tcctgggtcgacgatcaggtcgaggcctttaccgaggtggcccgcaactacctgatgccg
tccatccccgcgtag

DBGET integrated database retrieval system