KEGG   Salinibacter ruber M8: SRM_02423Help
Entry
SRM_02423         CDS       T01209                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srm  Salinibacter ruber M8
Pathway
srm00473  D-Alanine metabolism
srm00550  Peptidoglycan biosynthesis
srm01100  Metabolic pathways
srm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SRM_02423 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SRM_02423 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SRM_02423 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srm01011]
    SRM_02423 (ddlA)
Enzymes [BR:srm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SRM_02423 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:srm01011]
 Precursor biosynthesis
  Amino acid ligase
   SRM_02423 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CBH25344
UniProt: D5HBD9
LinkDB All DBs
Position
complement(2799650..2800954)
Genome map
AA seq 434 aa AA seqDB search
MPPSASFCFSSVPGPTVSSEPLQVGIVLGGVAPEHEVSVITALQAAAALDRDRYTPVPIY
VAKDGTWYTGDALLEVEAYRDLDALREDALPVALAPTPYGHLELLEDRAPGILKRLQRPA
LRRRIDVMLLGLHGGPGENGGVQGLCETFNVPYTSAGVFGSALGMDKVMSKRVCRQAGIP
VVDFVALREGEWAGREAAALDECEATLDYPLVVKPARCGSSIGIAQVNTRAELDAAIEDA
LRYDDKVVVEKAVEALREINCSVLGDGHEATPSVLEEPVPSDDDAVLTFQDKYMREDGEA
AKAEGGTKSAESSPEGMAAQDRIVPANLSDERTETIQDLAVRIFHQFECAGVVRIDFMID
ESTGRVYFNEINTIPGSFSFYLWEPSGVSFDALVDRLVTIARRRHRDRNGRVQTYDVNLL
AEKNLQGVKADEAP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctccgcatcgttctgtttctcgtccgtccccggccccactgtgtcctccgag
cccctacaggttggcatcgtcctcggcggggtggcccccgagcacgaggtgtcggtcatc
acggcgctgcaggccgccgcggcgctcgaccgcgaccggtacacgcccgtgcccatctac
gtcgcgaaggacggcacgtggtacacgggggacgccctgctggaggtggaggcgtaccgc
gacctggacgccctccgcgaggacgcgctgcccgtggccctcgcgccgacgccgtacggg
cacctcgagctgctcgaagaccgcgcgccgggcatcctgaagcgcctccagcgccccgca
ctgcggcgccggatcgacgtcatgctgctgggattgcacggcggccccggcgagaacggg
ggcgtgcagggcctctgcgagacgttcaacgtgccctacaccagcgccggcgtgttcggc
tccgccctcggcatggacaaggtcatgtcgaagcgggtgtgccggcaggccgggattccc
gtggtcgacttcgtggccctccgcgagggggaatgggccggccgggaggcggcggccctg
gacgagtgcgaggccaccctcgactacccgctcgtcgtgaagccggcccgctgcgggtcg
tccatcggcatcgcgcaggtgaacacccgggcggaactcgacgcggccatcgaggacgcg
cttcggtacgacgacaaggtggtcgtggagaaggcggtggaggcgctgcgcgagatcaac
tgctcggtgctgggcgacggccacgaggccacgcccagcgtgctggaggagccggtgccg
tcggacgacgacgcggtgctcacctttcaggacaagtacatgcgggaggacggagaggcg
gcgaaggcggagggcggcaccaaaagtgccgagtcgagcccggaaggcatggccgcccag
gaccgcatcgtgccggcgaacctctccgacgagcgcaccgaaacgattcaggacctggcc
gtccgcatcttccaccagttcgagtgcgccggggtcgtccgcatcgacttcatgatcgac
gagtcgaccgggcgggtctatttcaacgaaataaacaccatcccgggctcgttctcgttc
tacctgtgggagccgtccggcgtgtcgttcgacgcgctggtggaccggctggtgaccatc
gcccgccgccgccaccgcgaccggaacggacgggtccagacctacgacgtgaacctgctc
gccgagaagaacctgcagggcgtcaaggcggacgaggcgccctag

DBGET integrated database retrieval system