KEGG   Streptomyces rubrolavendulae: A4G23_00481
Entry
A4G23_00481       CDS       T04616                                 

Gene name
fdtB_1
Definition
(GenBank) dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00523  Polyketide sugar unit biosynthesis
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    A4G23_00481 (fdtB_1)
Enzymes [BR:srn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     A4G23_00481 (fdtB_1)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP HSL_N Aminotran_5
Other DBs
NCBI-ProteinID: AOT57691
UniProt: A0A1D8FWY4
LinkDB
Position
573151..574260
AA seq 369 aa
MKVPFLDLRPDSLGLASELDDAVRRVVASGRYLLGPELRAFEAEFAAYCESAHCVGVGSG
FDALELTLRALGIGAGHEVIVPAHTFIATWGAVAAAGAVPVPVEPDGYTACIDPARLDAA
VTPRTRAIMPVHLYGHPADLDAVHEVARRHGLHVVEDAAQAHGARYRGRRVGHGATAAAF
SFYPGKNLGALGDGGAVVTSDPELAARISLLRNYGSREKYRHETVSRNARLDEIQAAVLR
VKLGHLDEWNALRARTADRYLTELAGLDDLALPTTAEWAEPVWHLFVVRTAHRARLQRRL
AEAGVETLVHYPEPPHLSPAFADLGWAPGSLPLTERLAQEVLSLPMGPHLTPERTDRVIA
AVRESLGAS
NT seq 1110 nt   +upstreamnt  +downstreamnt
gtgaaggtgcccttcctcgatctgcggcccgactccctgggcctcgcctccgaactcgac
gacgcggtccgccgggtggtcgcctccgggcggtacctgctcggccccgagctgcgcgcg
ttcgaggcggagttcgccgcctactgcgagagcgcccactgcgtgggcgtcggcagcggc
ttcgacgcgctggagctgacgctgcgcgcgctcggcatcggagccgggcacgaggtgatc
gtcccggcgcacaccttcatcgcgacctggggcgcggtggccgccgccggcgcggttccg
gtcccggtggagccggacgggtacaccgcgtgcatcgacccggcccgcctcgacgccgcg
gtcaccccgcgcacccgggcgatcatgccggtgcacctctacggccatcccgccgacctg
gacgccgtgcacgaggtggcccgccggcacggcctgcacgtcgtggaggacgcggcccag
gcgcacggcgcccgctaccggggccgccgggtcggccacggtgccacggcggcggcgttc
agcttctacccgggcaagaacctgggcgcgctgggcgacggcggcgcggtggtcacctcc
gaccccgaactggccgcccgcatctcgctgttgcgcaactacggctcccgcgagaagtac
cggcacgagaccgtgtcccgcaacgcgcggctcgacgagatccaggcggcggtgctgcgt
gtcaagctcgggcacctggacgagtggaacgcgctgcgggcgaggacggcggaccgctac
ctgacggagctggccggtctggacgacctggcgctgccgacgaccgccgagtgggccgag
ccggtctggcacctgttcgtcgtgcgtacggcccaccgggcccggctccagcggcggctc
gccgaggcgggggtcgagaccctcgtccactacccggagccgccgcacctctcccccgcc
ttcgccgacctggggtgggcgcccgggagcctccccctgaccgagcggctcgcccaggag
gtcctcagcctgccgatgggcccccacctgacgccggaacggacggaccgggtgatcgcc
gcggtccgcgagagcctcggggcgagctga

DBGET integrated database retrieval system