KEGG   Streptomyces rubrolavendulae: A4G23_00670Help
Entry
A4G23_00670       CDS       T04616                                 

Definition
(GenBank) Undecaprenyl-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:srn01003]
    A4G23_00670
Enzymes [BR:srn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     A4G23_00670
Glycosyltransferases [BR:srn01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   A4G23_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AOT57874
UniProt: A0A1D8FXD7
LinkDB All DBs
Position
complement(806589..807446)
Genome map
AA seq 285 aa AA seqDB search
MKDDGQSQRRYGPLGSALVIIPTYNEAENIGPIVSRVRKAVPDAHILVADDNSPDGTGGI
ADELSARDPHVHVLHRKGKEGLGAAYLAGFRWGMERGYGVLVEMDADGSHRPEELPRLLT
ALKGADLVLGSRWIPGGRIVNWPKSREYLSRGASVYSRLMLGVPIRDVTGGFRAFRADTL
RGLGLEDVASQGYCFQIDLARRAVAAGFHVVEVPITFVEREHGDSKMSRDIVVEALWRVT
SWGVTSRAGRLTGREPLPGGGSPADRGARESREAGHGALDGRERR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacgacggtcagagtcagcggcggtacggaccgctgggcagtgccttggtgatc
attccgacctacaacgaggcggagaacatcgggccgatcgtctcccgggtacgcaaagcc
gtaccggacgcgcacatcctcgtcgccgacgacaacagcccggacggcaccggcgggatc
gccgacgagctgtccgcccgcgacccgcacgtccatgtactgcaccgcaagggcaaggag
ggcctcggcgcggcgtacctggcgggcttccgctggggcatggagcgcggctacggagtc
ctggtggagatggacgccgacggctcccaccggccggaggagctgccccggctcctcacc
gcgctgaagggcgccgacctcgtcctgggctcccgctggatccccggcggccggatcgtg
aactggccgaagtcgcgcgagtacctgtcgcggggcgccagcgtctactcgcggctgatg
ctgggcgtgccgatccgcgacgtcacgggcggcttccgggcgttccgcgcggacacgctg
cggggcctggggctggaggacgtggcctcgcagggctactgcttccagatcgacctcgcg
cgccgggcggtcgccgccgggttccacgtggtggaggtgcccatcacgttcgtggagcgc
gagcacggcgactccaagatgagccgggacatcgtcgtcgaggcgctgtggcgggtcacc
tcctggggcgtgacctcccgcgccggccggctgacgggccgcgagccgctgccggggggc
ggttcgccggccgaccgcggtgcgcgggagagccgggaggccggccacggggccctggac
ggccgcgagcggcgctga

DBGET integrated database retrieval system