KEGG   Streptomyces rubrolavendulae: A4G23_01074Help
Entry
A4G23_01074       CDS       T04616                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00051  Fructose and mannose metabolism
srn01100  Metabolic pathways
srn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A4G23_01074 (fucA)
Enzymes [BR:srn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A4G23_01074 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AOT58267
UniProt: A0A1D8FYI2
LinkDB All DBs
Position
complement(1254189..1254902)
Genome map
AA seq 237 aa AA seqDB search
MIDAMAKDPGRAAAHGPAAEAQDPDPVAEAWDALVATARRTVADGLVVGTSGNVSVRVGD
LVLVTPSGVPYTRLTGDDVVAVDLQGRRVRGSLPPTSELPMHLAVYRSTAAGAVVHTHAV
HATAVSTLVDELPPVHYMAAELGGPVRVAPYALYGTRELADHMLEALTDRSACLLRNHGT
VAHGATLDQAYDRTAQLEWMCRVWLTASSHPTRTPSLLTSADLAEASRKLRTYGPRP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgccatggcgaaggaccctgggagggccgcggcccacggccccgcggcggag
gcgcaggaccccgaccccgtggcggaggcgtgggacgccctggtggccacggcccgccgg
acggtggcggacggactggtcgtcggcacttcgggaaacgtgtccgtacgggtcggcgac
ctggtcctcgtcacccccagcggcgtcccctacacccggctgaccggcgacgacgtcgtc
gccgtggacctccagggccgccgggtgcgcggctcgctccccccgaccagcgaactgccg
atgcacctggccgtgtaccgctccaccgccgcgggcgcggtcgtccacacccacgccgtg
cacgccaccgccgtctcgaccctcgtcgacgagctgccgccggtccactacatggccgcc
gagctgggcggcccggtccgcgtcgccccgtacgccctctacggcacgcgggagctggcc
gaccacatgctggaggccctcaccgaccgctccgcctgcctgctgcgcaaccacggcacg
gtcgcccacggcgccacgctcgaccaggcgtacgaccggacggcccagctggagtggatg
tgccgggtctggctgaccgcctcctcccaccccacccgcaccccgtccctcctcacttcg
gccgatctcgccgaggcgtcccgcaaactgcgcacctacggcccccggccctag

DBGET integrated database retrieval system