KEGG   Streptomyces rubrolavendulae: A4G23_02157Help
Entry
A4G23_02157       CDS       T04616                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00620  Pyruvate metabolism
srn00680  Methane metabolism
srn01100  Metabolic pathways
srn01120  Microbial metabolism in diverse environments
srn01200  Carbon metabolism
Module
srn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4G23_02157 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    A4G23_02157 (ppc)
Enzymes [BR:srn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A4G23_02157 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOT59319
UniProt: A0A1D8G1K6
LinkDB All DBs
Position
complement(2535921..2538650)
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPSASAELRADIRRLGDLLGETLVRQEGHELLDLVEKVRRLTREDGEAAAELLG
DTDLETAARLVRAFSTYFHLANVTEQVHRGREMRARRAAEGGLLARTADMLKDGDPQHVR
ESIRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDEPVTAADRRRHDLRLAENIDLVWQ
TDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLAAELERVGYELPLGTRPLTFGTW
IGGDRDGNPNVTPAVTWEVLILQHEHGLTDAIEMIDELRGLLSNSIRYAGATQELLDSLQ
RDLDRLPEISPRYKRLNAEEPYRLKATCVRQKLVHTRERLAQGTPHQEGRDYLGTAELLD
DLTLIQTSLREHRGGLLADGHLDRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLG
EESWRYADMPREYRQKLLAKELRSRRPLAPTPAPLDAAGQKTLGVFHTVKAAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLVDLHAGWAKIGIVPLLETTDELRAADVILDEML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAATL
QASALHTGPRQPQEALARWDAAMDTASEAAHTAYRALVEDPDLPAYFFASTPVDQLAELH
LGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALRDAGLDDVLAEMY
ERWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPEPLKHVFATIEAEHALTVEQVLRVTG
ERELLDAQPVLKQTFAIRDAYLDPISYLQVALLKRQRDAAAADEPADPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagaccccctccgccagcgccgaactgcgcgccgacatccgccga
ctgggcgacctgctgggcgagacgctcgtacggcaggaggggcacgagctcctcgacctc
gtcgagaaggtccgccgcctgacccgcgaggacggcgaggccgccgccgagctgctcggc
gacaccgacctggagaccgccgcccgcctcgtccgcgccttctccacctacttccacctg
gccaacgtcaccgagcaggtccaccggggccgcgagatgcgcgcccgccgggccgccgag
ggcggcctcctcgcccgtacggcggacatgctgaaggacggcgacccgcagcacgtccgc
gagtcgatccgcaacctcaacgtccgcccggtcttcaccgcccacccgaccgaggccgcg
cgccgctccgtgctgaacaagctgcgccggatcgccgccctcctcgacgagccggtcacc
gccgccgaccgccgccgccacgacctgcggctcgcggagaacatcgacctcgtctggcag
accgacgagctgcgcgtcgtccggcccgagcccgccgacgaggcccgcaacgccatctac
tacctggacgagctgcacgccggcgccgtcggcgacgtcctggaggacctcgccgccgag
ctggagcgggtcggctacgagctgccgcttggcacgcgcccgctgaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaacgtgacgcccgccgtcacctgggaggtgctg
atcctccagcacgagcacggcctcaccgacgccatcgagatgatcgacgagctgcgcggc
ctgctgtcgaactccatccgctacgcgggcgccacccaggagctgctggactccctccag
cgcgacctggaccggctgcccgagatcagcccccgctacaagcggctcaacgccgaggag
ccctaccggctcaaggccacctgcgtccggcagaagctcgtgcacacccgcgagcgcctc
gcccagggcaccccgcaccaggagggccgcgactacctcggcaccgccgagctgctcgac
gacctcacgctcatccagacctcgctgcgcgagcaccgcggcggcctgctggccgacggc
cacctggaccgcacgatccgcacgctcgccgcgttcggcctccagctcgccaccatggac
gtgcgggagcacgccgacgcccaccaccacgcgctcggccagctcttcgaccggctcggc
gaggagtcgtggcggtacgcggacatgccgcgcgagtaccggcagaagctcctcgccaag
gagctgcgctcccgccgcccgctcgccccgaccccggcgccgctcgacgcggccgggcag
aagaccctcggcgtgttccacacggtgaaggcggcgttcgagcggttcggccccgaggtc
atcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtgttcgccgccgccgtc
ctcgcccgcgaggccggcctggtcgacctgcacgcgggctgggccaagatcggcatcgtg
ccgctgctggagaccaccgacgagctgcgggccgccgacgtcatcctggacgagatgctc
gccgacccgtcgtaccggcgcctggtctcgctccgcggcgacgtgcaggaggtcatgctc
ggctactccgactcctccaagttcggcgggatcaccacctcccagtgggagatccaccgc
gcccagcgcaggctccgcgacgtcgcccaccgctacggcgtgcggctgcgcctcttccac
ggccggggcggcacggtcggccgcggcggcggcccctcgcacgacgcgatcctcgcccag
ccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgaggtcatctccgac
aagtacctgatcccgtccctggcgcgggagaacctggaactgaccgtcgccgcgacgctc
caggcgtccgccctgcacaccgggccgcgccagccccaggaggccctggcccgctgggac
gcggcgatggacaccgcctcggaggccgcccacaccgcgtaccgggcgctcgtcgaggac
ccggacctgcccgcgtacttcttcgcctccacccccgtcgaccagctcgcggagctgcac
ctgggctcccgcccgtcccgccgccccgactcgggcgccgggctcgacgggctgcgggcc
atcccgtgggtgttcggctggacgcagtcccggcagatcgtgcccggctggtacggcgtc
ggctccggcctgaaggcgctgcgggacgcgggcctggacgacgtgctcgccgagatgtac
gagcggtggcacttcttccgcaacttcctgtcgaacgtcgagatgaccctcgccaagacg
gacctgcggatcgcccgccactacgtcgacacgctcgtccccgagccgctcaagcacgtc
ttcgccaccatcgaggccgagcacgcgctgaccgtggagcaggtcctgcgggtcaccggc
gagcgggagctgctggacgcgcagcccgtgctgaagcagacgttcgccatccgcgacgcc
tacctggacccgatctcctacctccaggtcgccctgctgaagcggcagcgcgacgcggcc
gccgccgacgagccggccgacccgctgctggcccgcgccctgctgctcaccgtgaacggt
gtcgcggcgggcctgcgcaacacgggctga

DBGET integrated database retrieval system