KEGG   Streptomyces rubrolavendulae: A4G23_04371
Entry
A4G23_04371       CDS       T04616                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase precursor
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00521  Streptomycin biosynthesis
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A4G23_04371 (phoA)
Enzymes [BR:srn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     A4G23_04371 (phoA)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-ProteinID: AOT61483
UniProt: A0A1D8G7R3
LinkDB
Position
complement(5077960..5079306)
AA seq 448 aa
MKYMVTGSTPYTRRALAGAALLVAGTVTGPAAALRGTERDASRARSVILLVGDGMGDSEI
TLARNYTVGAGGRLHMDGFPMTGMYTTCSVDRDGRPNYVTDSAASATTWATGHKTVNDRI
SKTADDRAVPTILELARQGGLVTGSVTTAELTDATPAALTSHVTHRSCQGPADMERCPTD
TRAAGGPGSITEQTVAHRGDVLLGGGRQRFDQTITQGPERGATVLERARQHGYRVATDAR
DLDAVRPGRPVLGLFAPEELPVAWTRTPAAVGGTASQRCVTDREPSDDIPSLEALTRKAI
ALLDARARQGAGKGFFLQVEGASIDKQNHDADPCGQIGETVAFDQAVKAAREYAARHPDT
LVIATADHRHSSQIVPMAARPAGLSETLITDEGAPMKVSYGTHAGEEGQEHSGVQVRIAA
EGPEAHRVLGTTDQTQLFTTLRIAPNLQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaaatacatggtaacggggagcaccccttacacgcggcgggccttggcaggcgccgca
ctgctcgttgccggcaccgtgacggggcccgccgcggcgttgcgcggaaccgagcgggac
gcctcgcgggcacgcagcgtgatccttctggtcggcgacggcatgggcgactccgagatc
accctcgcgcgcaactacaccgtcggcgctggcggtcggctccacatggacggcttcccg
atgaccgggatgtacaccacctgctccgtggacagagacggacgtcccaactacgtcacc
gactctgcggccagcgccacaacctgggccaccggccacaagacggtgaacgaccggata
tccaagacggccgacgaccgcgccgtccccacgatcctggagctcgcccggcagggcgga
ctcgtcaccggcagcgtcaccaccgccgagctgaccgacgccacccccgccgccctcacc
tcgcacgtcacccatcgcagttgccagggcccagccgacatggagcggtgcccgacggac
actcgggcggcgggcggcccgggctccatcaccgagcagacggtcgcccaccgcggcgac
gtgctcctcggcggtggcaggcaacgattcgaccagaccatcacccaaggtccggagcgt
ggcgccactgtgctggagcgtgcgcgtcagcatggctatcgcgtggccacggacgccagg
gacctggacgccgtccgccccgggcgaccggttctgggcctgttcgcaccggaggagctg
ccggtcgcctggaccagaacgccggccgcggtcggcggcaccgcatcacagcgctgcgtg
accgaccgcgagccctccgacgacatcccgagtctggaggcgctgacgcgcaaggcaatt
gccctgctggatgcccgagcacgccagggcgcggggaagggattcttccttcaggtcgaa
ggggcctccatcgacaagcagaaccacgatgccgacccctgcggccagatcggtgagacc
gtcgccttcgaccaagccgtcaaagccgccagggagtacgccgcacgacaccctgacacc
ctcgtcatcgccaccgccgaccacaggcacagcagccagatcgtgcccatggcggccagg
cccgcaggactctctgagacgctgatcacggacgagggcgccccgatgaaggtcagctac
ggcacgcacgcgggcgaggagggccaggagcacagcggcgtacaggtccgcatcgcggcc
gaagggcccgaggcgcacagggtgctcggcaccacggaccagacccagctgttcaccact
ctccgcatcgctcccaacctgcagtga

DBGET integrated database retrieval system