KEGG   Streptomyces rubrolavendulae: A4G23_04997Help
Entry
A4G23_04997       CDS       T04616                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
srn  Streptomyces rubrolavendulae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C Lipase_GDSL_2 mRNA_cap_enzyme HTH_53
Motif
Other DBs
NCBI-ProteinID: AOT62104
UniProt: A0A1D8G9H5
LinkDB All DBs
Position
complement(5896482..5897570)
Genome map
AA seq 362 aa AA seqDB search
MVRAQNRAMDLPVMPPVKPMLAKSVKTIPPGMQYEAKWDGFRAVVHRDGDEVVIGSRTGK
PLTRYFPELVDAVRERLPRRCVVDGEIVVAHGGRLDFDRLSERIHPADSRVRTLAERTPA
RFVAFDLLALDDASLMDAPLSERRAALERVLGGVRPPVHVAPATTDPAVAERWFERYEGA
GLDGVVAKPLDLRYRPDVRAMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDSGGVL
QHVGVCAAFTAARRAELVEELAPLVMDPPDGHPWASWAEAAAHEGARLPGAPSRWTGRKD
LSWVPLRPERVCEVGYDHMEGDRFRHTAQFRRWRPDRTPESCGYGQLEEPVSYDLDEVLS
GA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtccgggcgcagaatcgtgccatggacctgccggtgatgccgcccgtgaagccgatg
ctcgccaagagcgtcaagacgatcccgccggggatgcagtacgaggcgaagtgggacggc
ttccgggccgtcgtccaccgcgacggcgacgaggtggtcatcggcagccgcaccggcaag
ccgctgacccggtacttccccgagctggtggacgcggtgcgcgagcggctgccgcgacgg
tgcgtggtggacggcgagatcgtggtcgcgcacggcggccggctcgacttcgaccggctc
tccgagcgcatccaccctgcggactcgcgggtgcggacgctggcggagcggaccccggcc
cggttcgtcgccttcgacctgctggcgctggacgacgcgtccctgatggacgcgccgctc
agcgagcggcgggcggcgctggagcgggtgctcggcggggtgcggcccccggtgcacgtg
gcgcccgccaccaccgatccggcggtggcggagcggtggttcgagcggtacgagggcgcc
ggcctggacggggtggtcgccaagccgctcgacctgcgctaccggccggacgtgcgggcc
atgtacaagatcaagcacgagcggacggcggatgtggtcgtggccggctaccggctccac
aagagcggtccggtcgtgggctccctgctgctcggtctgtacgactccggcggcgtcctc
cagcacgtcggggtgtgcgccgcgttcaccgcggcgcggcgcgcggagctcgtcgaggag
ctggcgccgctggtcatggacccgcccgacgggcacccgtgggcgtcctgggccgaggcc
gccgcgcacgagggggcgcggctcccgggtgcgccgagccgctggaccggccggaaggac
ctgtcgtgggtgccgctgcgcccggagcgggtgtgcgaggtggggtacgaccacatggag
ggcgaccggttccggcacaccgcgcagttccgccggtggcgcccggaccgcaccccggag
agctgcggctacgggcagctggaggagccggtgtcgtacgacctggacgaggtgctctcg
ggcgcgtga

DBGET integrated database retrieval system