KEGG   Streptomyces rubrolavendulae: A4G23_05108Help
Entry
A4G23_05108       CDS       T04616                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00020  Citrate cycle (TCA cycle)
srn00480  Glutathione metabolism
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
srn01120  Microbial metabolism in diverse environments
srn01130  Biosynthesis of antibiotics
srn01200  Carbon metabolism
srn01210  2-Oxocarboxylic acid metabolism
srn01230  Biosynthesis of amino acids
Module
srn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4G23_05108 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4G23_05108 (icd)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A4G23_05108 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AOT62214
UniProt: A0A1D8G9T3
LinkDB All DBs
Position
complement(6020289..6022508)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASAAGVSVETRDISLAGRIIASFPEYLQEGQ
RIDDALAELGELAKTPGANIIKLPNISASIPQLKAAVAELQEQGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGADD
FRSTEKSAVVAEDGSLRIELAGEDGSTTVLRESVPVLAGEVVDASVMRAEALRAFLSEQV
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAAYGDVLAGAGLSPNDGLGGI
LKGLDSLPQGEEIKASFDAELAEGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGKEADTLAVLPDSSYSGVYQAVIEDCRAHGALDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIAQPGTVRVVDQAGEVVLEQPVGRGDIFRMCQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDARLIEKVKAYLPEHDTEGLRIEIMPPVEATKFSLERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLSQVTGNARAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LALYWAQELARQTDDAALAEAFGPLAKTLTEQEGAIVEELNAVQGEPADIGGYYQPDPEK
AAAVMRPSRTFNQALGTLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacccacactgacgaggccccggccctggcgacgtac
tcgttcctgcccgtggtccaggcgtacgcctcggcggccggcgtcagcgtcgagacccgc
gacatctcgctggccgggcggatcatcgcctccttcccggagtacctccaggaggggcag
cgcatcgacgacgccctcgccgagctgggcgagctggcgaagacgcccggcgccaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctgaaggccgccgtcgcggagctg
caggagcagggctacgcgctgccggactacccggacgacccgaagacggacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactcggaccgccgcgcccccgcgtcggtcaagaactacgccaaggcgcacccgcac
cgcatgggcgcctggacggccgactccaagacgaacgtggcgacgatgggcgccgacgac
ttccggtccaccgagaagtcggcggtcgtcgccgaggacggctcgctgcgcatcgagctg
gccggcgaggacggctcgacgaccgtgctgcgcgagtccgtgcccgtgctggcgggcgag
gtcgtggacgcgtcggtgatgcgcgccgaggcgctgcgcgccttcctctccgagcaggtc
gcccgcgccaaggccgagggcgtgctgttctccgtccacctgaaggcgacgatgatgaag
gtctcggacccgatcatcttcggccacgtggtccgcgcgttcttcccgaagaccttcgcc
gcctacggcgacgtgctggccggcgccggcctgagcccgaacgacggcctcggcggcatc
ctgaagggcctggactccctgccgcagggcgaggagatcaaggcgtccttcgacgccgag
ctggccgagggcccggccctggccatggtcgactccgaccgcggcatcaccaacctgcac
gtaccgagcgacgtcatcgtcgacgcgtcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggcaaggaggccgacaccctcgcggtcctgcccgacagcagctac
tccggcgtgtaccaggccgtcatcgaggactgccgcgcccacggcgccctcgacccggcg
accatgggctccgtgccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgcgcagcccggcaccgtccgcgtggtcgaccaggccggc
gaggtcgtcctggagcagccggtcggccgcggcgacatcttccgcatgtgccagacgaag
gacgccccgatcagggactgggtgaagctcgccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgcccggctcatcgagaaggtc
aaggcgtacctgccggagcacgacaccgagggcctccggatcgagatcatgccgccggtc
gaggcgacgaagttctccctggagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctcggcaccagc
gccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctcttcgagacgggtgcg
ggcggctccgccccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
agcctcggcgagttcctcgcgctggcggtcagcttcgagcacctctcgcaggtcacgggc
aacgcccgtgccaaggtcctcgcggacaccctggaccgcgccacggccaccttcctcaac
gaggacaagtcgccgacccgccgcgtcggcggcatcgacaaccgcggcagccacttctac
ctcgccctgtactgggcgcaggagctggcgcggcagacggacgacgccgcgctcgccgag
gcgttcgggccgctcgcgaagaccctcaccgagcaggagggcgcgatcgtcgaggagctg
aacgcggtgcagggcgagccggccgacatcggcggctactaccagcccgacccggagaag
gcggcggcggtcatgcgcccgtcccgcaccttcaaccaggcgctggggaccctggcctga

DBGET integrated database retrieval system