KEGG   Streptosporangium roseum: Sros_1173Help
Entry
Sros_1173         CDS       T01137                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sro  Streptosporangium roseum
Pathway
sro00564  Glycerophospholipid metabolism
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sros_1173
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Sros_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8 Pyr_redox GMC_oxred_N GIDA AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACZ84171
UniProt: D2BBE8
LinkDB All DBs
Position
1195423..1197159
Genome map
AA seq 578 aa AA seqDB search
MTARMGTARLGPAERTAALTQMGAQELDVVVIGGGVVGAGVALDAATRGLSVGLLEARDF
ASGTSSRSSKLIHGGLRYLEQLNFDLVREALRERALLLQRIAPHLVRPVPFLLPLTHVGW
ERPYVGAGLVMYDSLGFSFGSTRGVPGHRHLSRSRALRIAPSLRRTAFSGAVQYWDAQVD
DARYVMTMLRTASSYGAHVASRAQVVGFLREGERVTGVRVRDLEAGTTMDVRARQVVNAT
GVWTDDIQELVGGRGQIHVRASKGIHLVVPRDRIHSLTGIILRTEKSVLFVIPWGRHWII
GTTDTRWDLNRAHPAASRSDIDYVLEHVNEVLSVPLTRDDVEGVYAGLRPLLSGESEETS
KLSREHMVAHPVPGLVMVAGGKYTTYRVMAQDAVDAVAHGLDQRVPPSCTDRIPLAGAEG
YQALWNSRQRLAQSSGLHVARIEHLLQRYGSMIDEVLALIEADPSLALPLTGADDYLRAE
IVYAATHEGARHLNDVLARRTHISIETFHRGLGVVEEAAGLLAGPLEWDDDQVKREVEYY
TKRVEAERLSQEQDTDQEADAIRLGAPDVVPVASPENT
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgaatgggcacggcacggctcggtcctgccgagcggaccgccgcactgacg
cagatgggcgctcaggaactcgacgtggtggtgatcggcggcggcgtcgtcggcgccgga
gtcgcgctggacgcggcgacgcgcgggctgagcgtcgggctgctggaggcgcgcgacttc
gcctcgggcacctcgtccagatcgtccaaactgatccacggcgggctgcgctatctggag
cagctcaacttcgacctggtcagggaggcgctccgggagcgggccctgctgctgcagcgg
atcgccccgcacctcgtgcggcccgtgcctttcctgctcccgctcacccacgtcgggtgg
gagaggccgtacgtcggagcgggcctggtgatgtacgactcgctgggcttctccttcggc
tccacccgtggcgtgcccgggcaccggcacctgtcgcgcagcagggcgctgcggatcgcg
ccctcgctgcggcggacggcgttctccggcgcggtccagtactgggacgcccaggtcgac
gacgcccgctacgtgatgaccatgctgcggaccgcctcctcctacggggcgcacgtggcg
tcgcgggcccaggtggtgggcttcctgcgggagggcgagcgggtcaccggggtccgggtg
cgcgacctggaggccgggaccacgatggacgtgcgggcccgccaggtggtcaacgccacc
ggcgtgtggaccgacgacatccaggagctggtcggcggccgggggcagatccacgtccgc
gcctccaagggcatccacctggtcgtgccgcgcgaccggatccactccctcaccggcatc
atcctgcgcaccgagaagtcggtgctgttcgtgatcccctggggacgccactggatcatc
gggaccaccgacacccgctgggacctgaaccgggcccacccggcggcctcccgctcggac
atcgactacgtgctggagcacgtgaacgaggtgctctcggtgccgctcacccgcgacgac
gtcgagggcgtctacgcggggctgcgcccgttgctgtcgggggagtcggaggagacgtcc
aagctctcccgcgagcacatggtggcccatccggtgccgggactggtcatggtggccggc
gggaagtacaccacctaccgggtcatggcgcaggacgcggtggacgcggtggcgcacggg
ctggaccagcgggtcccgccgtcgtgcacggaccggatcccgctggcgggggcggagggc
taccaggcgctgtggaactcccggcagcggctggcccagtcgtccgggctgcacgtggcg
cggatcgagcacctgctgcagcggtacgggtccatgatcgacgaggtgctcgcgctgatc
gaggcggacccgtcgctggccctcccgctgaccggggcggacgactacctgcgggcggag
atcgtctacgcggccacccacgagggcgcccgccatctgaacgacgtgctggcccggcgc
acgcacatctcgatcgagaccttccaccgcgggctgggcgtggtcgaggaggcggccggg
ctgctcgccggcccgctggagtgggacgacgatcaggtcaagcgcgaggtggagtactac
accaagcgggtcgaggccgagcggctctcccaggagcaggacaccgaccaggaggccgac
gcgatccgcctcggcgctcccgacgtcgtccccgtcgcgagccccgagaacacctga

DBGET integrated database retrieval system