KEGG   Streptosporangium roseum: Sros_1254Help
Entry
Sros_1254         CDS       T01137                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sro  Streptosporangium roseum
Pathway
sro00020  Citrate cycle (TCA cycle)
sro00480  Glutathione metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01200  Carbon metabolism
sro01210  2-Oxocarboxylic acid metabolism
sro01230  Biosynthesis of amino acids
Module
sro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sro_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sros_1254
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sros_1254
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sros_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ACZ84252
UniProt: D2BD11
LinkDB All DBs
Position
1285760..1286974
Genome map
AA seq 404 aa AA seqDB search
MPKIKVEGPVVELDGDEMTRIIWQFIKDQLILPYLDVDLKYYDLGIEHRDATDDQVTIDA
ANAIKQYGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILGGVIFREPIIMSNVPRL
VPGWTKPIIIGRHAFGDQYRATDLKIPGEGTLTLTYTPKDGSEPIELDVYDFPGSGIAMA
MYNLDDSIRDFARASMRYGLSRGYPVYLSTKNTILKAYDGRFKDIFAEVFETEFKAEFEA
AGITYEHRLIDDMVAAALKWEGGYVWAAKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDGR
TVEAEAAHGTVTRHYREHQKGNPTSTNPIASIFAWTRGLAHRGKLDNTPAVIDFAEKLEQ
VCVETVEGGQMTKDLALLVGGDAKWLTTQDFLAALDENLKKKMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcaaggtagagggccccgtcgtcgagcttgacggcgacgagatgacccgg
atcatctggcagttcatcaaggaccagctgatccttccctacctcgacgtcgacctgaag
tactacgacctcgggatcgaacaccgcgacgccaccgacgaccaggtgacgatcgacgcg
gccaatgccatcaagcagtacggcgtcggcgtcaagtgcgccacgatcaccccggacgag
gcgcgggtcgaggagttcggcctgaagaagatgtggaagtccccgaacgggaccatccgt
aacatcctcggcggcgtcatcttccgcgagccgatcatcatgtccaacgtgccgaggctc
gtccccggctggacgaagccgatcatcatcggccgtcacgcgttcggcgaccagtaccgc
gccaccgacctgaagatccccggcgagggcaccctgaccctcacctacacgccgaaggac
ggctcggagccgatcgagctcgacgtctacgacttccccgggtccggcatcgcgatggcg
atgtacaacctggacgactcgatccgtgacttcgcccgcgcctccatgcgctacggcctg
tcccgcggctacccggtctacctctccacgaagaacacgatcctgaaggcctacgacggc
cgcttcaaggacatcttcgccgaggtcttcgagaccgagttcaaggccgagttcgaggcc
gccgggatcacctacgagcaccgcctgatcgacgacatggtcgccgcggcgctcaagtgg
gagggcggctacgtctgggcggccaagaactacgacggcgacgtccagtccgacacggtc
gcgcagggcttcggctcgctcggcctgatgacctcggtcctgctgacccccgacggccgg
accgtcgaggccgaggccgcccacggcaccgtgacccggcactaccgtgagcaccagaag
ggcaaccccacctccaccaacccgatcgcctcgatcttcgcgtggacccggggcctcgcc
caccgcggcaagctcgacaacacccccgcggtgatcgacttcgccgagaagctggagcag
gtctgcgtcgagaccgtcgaaggcggccagatgaccaaggacctcgccctcctcgtcggc
ggcgacgccaagtggctgaccacccaggacttcctggcggcgctggacgagaacctgaag
aagaagatggcctag

DBGET integrated database retrieval system