KEGG   Streptosporangium roseum: Sros_1947Help
Entry
Sros_1947         CDS       T01137                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sro  Streptosporangium roseum
Pathway
sro00250  Alanine, aspartate and glutamate metabolism
sro00410  beta-Alanine metabolism
sro00640  Propanoate metabolism
sro00650  Butanoate metabolism
sro01100  Metabolic pathways
sro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sros_1947
   00650 Butanoate metabolism
    Sros_1947
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sros_1947
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sros_1947
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sro01007]
    Sros_1947
Enzymes [BR:sro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sros_1947
Amino acid related enzymes [BR:sro01007]
 Aminotransferase (transaminase)
  Class III
   Sros_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACZ84935
UniProt: D2AUS3
LinkDB All DBs
Position
2087063..2088364
Genome map
AA seq 433 aa AA seqDB search
MSDLLARHRAVMPNWLALYYNEPIEIVGGKGNRVVDASGKSYLDFFAGILTNMIGYDVPE
VREAVERQLATGVVHTSTVYLLRGQVELAEKIAKLSGIKDAKVFFTNSGTEANETALLLA
TYARKSDQVLAMRQSYHGRSFGAVSVTSNRAWKNNSLSPLNVHFLHGADRHLTQFRGLSD
ADYIKACVDDLRHVLSTSVSDDVAALIAEPIQGVGGFTMAPDGLFAAYKEVLDEQGILFV
SDEVQTGWGRTGSAFFGIQNHGVTPDMMTFAKGLGNGFAVGGVVARGDLMDNLHAVGLAT
FGGNPISMAAANATLDYVLDHDLQANAARTGALIIDGLREAAPRLPIVGDVRGKGLMFAV
ELVDPATGEPSPALAARFMEETKKAGLLAGKGGLYGNVLRMAPPLTLTPDEAAEGLGIIV
NALEVINAEVVPS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccttctcgcacgccaccgggcggtaatgcccaactggctggccctctattac
aacgagcccatcgagatcgtcggcggcaagggcaaccgggtcgtcgacgcgtcggggaag
agctatctggacttcttcgcgggcatcctgaccaacatgatcgggtacgacgtgcccgag
gtgcgcgaggccgtcgagcgccagctcgccaccggggtcgtccacacctccacggtctac
ctgctccgaggccaggtcgagctcgccgagaagatcgccaagctgtccggtatcaaggac
gcgaaggtcttcttcaccaactccggcaccgaggccaacgagaccgcgctgctgctggcg
acctacgcgcgcaagtccgaccaggtgctcgccatgcggcagagctaccacggccgctcc
ttcggcgcggtcagcgtgaccagcaaccgcgcatggaagaacaactcgctgtcgccgctg
aacgtgcacttcctgcacggcgccgaccggcacctcacgcagttccgcgggctgtcggac
gccgactacatcaaggcgtgcgtcgacgacctgcgccacgtgctctccacgtccgtctcc
gacgacgtggccgcgctcatcgccgagccgatccagggtgtcggcgggttcaccatggcc
cccgacgggctgttcgccgcctacaaggaggtcctggacgagcagggcatcctgttcgtc
tccgacgaggtgcagaccggctggggccgtaccggctcggccttcttcggcatccagaac
cacggcgtcacgccggacatgatgaccttcgccaaggggctgggcaacggcttcgcggtc
ggcggcgtcgtggcccgcggcgacctgatggacaacctgcacgcggtcggtctcgcgacc
ttcggcggcaacccgatctcgatggccgccgccaacgcgacgctggactacgtcctcgac
cacgacctgcaggcgaacgccgcccggaccggtgccctgatcatcgacgggctccgcgag
gccgcgccgcgcctgccgatcgtcggcgacgtccgcgggaagggcctgatgttcgccgtc
gagctcgtcgacccggcgaccggcgagccctccccggcactcgcggcccggttcatggag
gagaccaagaaggccggtctgctcgcgggcaagggcggcctgtacggcaacgtgctccgc
atggccccgccgctcaccctgacgccggacgaggccgccgagggcctcgggatcatcgtc
aacgcactcgaagtcatcaacgccgaggtggtcccgtcgtga

DBGET integrated database retrieval system