KEGG   Streptosporangium roseum: Sros_3277Help
Entry
Sros_3277         CDS       T01137                                 

Definition
(GenBank) ABC transporter CydDC cysteine exporter (CydDC-E) family permease/ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
sro  Streptosporangium roseum
Pathway
sro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Sros_3277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sro02000]
    Sros_3277
Transporters [BR:sro02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Sros_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane AAA_16 AAA_29 SMC_N MMR_HSR1 RsgA_GTPase AAA_25 AAA_22 AAA_33 NACHT AAA_30 AAA_18 AAA_28 AAA AAA_7 AAA_24 AAA_23 DUF815
Motif
Other DBs
NCBI-ProteinID: ACZ86216
UniProt: D2BDC7
LinkDB All DBs
Position
complement(3567656..3569335)
Genome map
AA seq 559 aa AA seqDB search
MNRAGGRMALAAAAGAAAELAGLGLIGSAAWLITRAAEQPPLAALSVAIVGVRAFATSKG
VFRYGERLAGHDVALRAQATTRERLYQALIPAGPLNHRGADLLSRMVDDTDAAQDLLVRC
LLPAVAALVTAVATVVVALFLLPAAALVLLAGLAVAGVLIPAGTAAAARRWSARIAPARA
DLAARVADLVHGSADLAAYGAGDRALAACAEADARLAALERRQARGNAVATGLGMLAQGL
TVLAIVLVAQNSGAGSVATAVLALTSLVSFEPVLPLAAAGERLTGVLAALRRLREVRATP
PAVTDPVAPASVPGGPLTVEIDDLVVRHSADRSPALNGVSLTLTPGRRVALVGPSGAGKS
TLLSALMRLVEPESGTIRLSGVEIGELSADDARRVMTGLTQDPYVFQASLRDNLRLAGPE
AGEDALAEAVRRARLERWVERTGWDTVLGEDGRTVSGGQLQRLALARALLNDPPVLLLDE
PAEALDEETADALMADLLDATHGHTTLLVTHRLRGLEQVDEIVVLENGSVIQRGTHGELV
DTPGYYRDLWRSEALTAGR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgggcaggtgggcggatggctctcgccgccgcggcgggcgccgcggccgagctg
gccgggctcgggctgatcgggtcggcggcatggctgatcaccagggccgccgagcagccg
ccgctggcggcgctgagcgtggcgatcgtcggggtccgggcgttcgccacgagcaagggc
gtcttccggtacggcgagcgcctggccgggcacgacgtcgcgctgcgggcgcaggccacg
acccgggagcggctgtaccaggcgctcatcccggccgggccgctgaaccaccggggggcc
gacctgctcagccggatggtcgacgacaccgacgcggcccaggacctgctggtgcgctgc
ctgctgccggcggtggcggcgctggtcaccgcggtggccaccgtcgtggtcgcgctgttc
ctgctcccggcggcggcgctggtgctgctggccgggctggccgtggccggagtgctgatc
ccggcgggcacggccgccgctgcccggcgctggtcggcacggatcgcccccgcgcgggcc
gacctggccgcccgggtcgccgacctggtgcacggctccgccgacctggccgcctacggg
gccggcgaccgggcgctcgcggcctgcgccgaggccgacgcccggctggccgcgctggag
cgccggcaggcccgggggaacgcggtggccacggggctggggatgctcgcccaggggctg
accgtgctggcgatcgtcctggtcgcgcagaactccggagcgggctcggtcgccacggcg
gtgctcgcgctgacgtcgctggtgtcgttcgagccggtgctgccgctggccgcggccggc
gagcggctgaccggggtgctggccgccctgcgccgtctcagggaggtccgcgcgacccct
cccgccgtgaccgaccccgtggctcccgcctccgtccccggcggcccgctgaccgtcgag
atcgacgacctggtggtccggcacagcgccgaccgctcccccgccctcaacggcgtcagc
ctcaccctcacccccggcaggcgcgtcgccctggtcggccccagcggggccggcaagagc
accctgctgtcggccctgatgcgcctggtggagcccgagtccggcacgatccggctgagc
ggggtggagatcggggaactgtcggcggatgacgcccggcgggtgatgacggggctgacc
caggatccgtacgtgttccaggcctcgctgagggacaaccttcggctggccggcccggag
gccggcgaggacgcgctggcggaggcggtgcggcgggcccgcctggagcggtgggtggag
cggaccgggtgggacaccgtcctcggcgaggacgggcggacggtgtccggggggcagttg
cagcggctggcgctggcacgggcgctgctgaacgacccgccggtactgctgctggacgag
cccgccgaggcgctggacgaggagacggcggacgcgctcatggccgacctgctggacgcc
acccacggtcacacgacgttgctggtcacccaccgcctccgcgggctggagcaggtggac
gagatcgtcgtgctggagaacggctcggtgatccagcggggcacccacggggagctggtg
gacaccccgggctactaccgcgacctgtggcggtcggaggccctgaccgcgggacggtga

DBGET integrated database retrieval system