KEGG   Streptosporangium roseum: Sros_6710Help
Entry
Sros_6710         CDS       T01137                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sro  Streptosporangium roseum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACZ89419
UniProt: D2B3Y4
LinkDB All DBs
Position
7383155..7384195
Genome map
AA seq 346 aa AA seqDB search
MRLPIAPPLAPMLAKAVRSLPPQDGTLFYEPKWDGFRCVVFRDGDEVYLGSRNERPFTRY
FPELVEAVRAELPDRVVVDGEIVVRDGQTLDFEALQQRIHPAASRVRLLAGQTPASFVAF
DLLALGEESLLDVPFAARRTRLESIFGGAGHAVRLTPITTSEERAAEWFAAFEGAGLDGI
VVKPGGLPYQPDKRVMSKVKHERTADVVVAGYREHKSGPVVGSLLLGLHDAEGVLHHVGV
AASFTMKRRAELVEELAPYVSRDGDHPWSAASLPGAISKWSATKDLSFVPLRSELVVEVA
YDHMEGRRFRHTAQFRRWRPDRTPESCTYEQLERPVSYDLDDILTG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgccgatcgcgccgccgctcgcgccgatgctggccaaggcggtcaggagcctg
ccgccgcaggacggcaccctgttctacgagcccaagtgggacggcttccggtgcgtggtg
ttccgcgacggggacgaggtctatctcggcagccgcaacgagcggccgttcacgcgctac
ttccccgagctggtcgaggcggtgcgggcggagctgcccgaccgggtggtggtcgacggg
gagatcgtcgtccgcgacggccagacgctcgacttcgaggccctgcagcagcgcatccat
ccggccgcctcccgggtgcggctgctggccgggcagaccccggcgtcgttcgtcgccttc
gacctgctggccctgggtgaggagtccctgctggacgtcccgttcgcggcccgtcgcacg
aggctggagtcgatcttcggcggcgcggggcacgcggtgcggctgacgccgatcaccacg
tccgaggagcgggccgccgagtggttcgccgccttcgagggcgcggggctggacggcatc
gtggtcaagccgggcggcctgccgtaccagccggacaagagggtcatgtccaaggtcaag
cacgagcggacggccgacgtggtggtggccggataccgggagcacaagtcgggcccggtg
gtcgggtccctgctcctggggctccacgacgccgagggcgtgctccaccacgtcggcgtc
gcggcgtccttcacgatgaagcgccgggccgagctggtcgaggagctcgccccgtacgtg
agccgggacggcgaccatccctggagcgccgcctcgctgcccggcgcgatctccaagtgg
agcgccaccaaggacctgtcgttcgtgcccctgcggtcggagctggtggtggaggtcgcc
tacgaccacatggaggggcgccgtttccggcacaccgcccagttccgccgctggcgcccc
gaccgcactcccgagtcgtgcacctacgagcagctcgaacggccggtctcctacgacctg
gacgacatcctgaccggttag

DBGET integrated database retrieval system