KEGG   Streptosporangium roseum: Sros_6986
Entry
Sros_6986         CDS       T01137                                 

Definition
(GenBank) hydroxyneurosporene-O-methyltransferase
  KO
K21178  O-methyltransferase [EC:2.1.1.-]
Organism
sro  Streptosporangium roseum
Pathway
sro01059  Biosynthesis of enediyne antibiotics
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sros_6986
Enzymes [BR:sro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Sros_6986
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_25 MTS Dimerisation Methyltransf_12 Rrf2
Other DBs
NCBI-ProteinID: ACZ89686
UniProt: D2B8T0
LinkDB
Position
7701801..7702805
AA seq 334 aa
MLSDEDGAGAGLWAMAHLGTPMALRTAATLRIADHIVAGLRTAPELAEAVKADADALERL
MRYLAARGILSRDGSGSYDLTAQGAALRDDHPSGMRSLLDIEGAGRAELAFAQLLHSVRT
GEASYSLQFGRSFWEDLAANPAQGASFDAWMSANVPTRVPELLSCYDWGSLGHVIDVGGG
DGSLLTALLTEYPELRGTVVDLPGTAEAARKALAAAGLVDRADVVSGSFFDPLPPGAGGY
LLSWIIHDWNDTASRAILRRCAEAAGSGGRVFVVESVDAGGGAPHTGMDLRMLVYCGGKE
RGVDELTALAAGCGLRPVAVHAAGTLSVLELTVG
NT seq 1005 nt   +upstreamnt  +downstreamnt
gtgttgtccgatgaggacggagcgggcgccggattgtgggcgatggcgcaccttgggacg
ccgatggcgttgcgtacggcggcgacgctgcggatcgccgaccacatcgtggccggcctg
cgcaccgcgcccgagctggccgaggcggtgaaggccgacgccgacgcgctggagcggctg
atgcgctacctcgccgcccgggggatcctgagtcgcgacggatcggggagctacgacctg
accgcccagggggcggcgctgcgtgatgatcacccttccggcatgcgctccctgctcgac
atcgagggcgcgggccgcgcggagctggccttcgcccagctgctgcacagcgtccgcacc
ggcgaggcctcctactcgctgcagttcggccgctcgttctgggaggacctggcggcgaat
ccggcacagggcgcctctttcgacgcgtggatgagcgccaacgtcccgacccgcgtcccc
gagctcctgtcgtgttacgactggggatcgctgggacacgtgatcgacgtcggcggcggc
gacggctcgctgctgaccgcgctgctgaccgagtatccggagctgcggggcacggtcgtg
gatctgccgggcaccgccgaggccgcgcgcaaggcactggcggcggccggtctggtcgac
cgcgccgacgtggtcagcgggagcttcttcgacccgctgccgccgggcgccggagggtac
ctgctgtcgtggatcatccatgactggaacgacaccgcctcccgggcgatcctgcggcgc
tgcgcggaggccgcgggcagcggcggcagggtgttcgtcgtggagagcgtcgacgccggc
ggtggcgctccgcacaccggaatggacctgcggatgctcgtctactgcggcggcaaggag
cgcggagtggacgagctgaccgcgctggccgccggctgcgggctccggccggtggcggtg
cacgcggccggcacgttgtcggtcctggaactgaccgttgggtga

DBGET integrated database retrieval system