KEGG   Streptosporangium roseum: Sros_7700Help
Entry
Sros_7700         CDS       T01137                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sro  Streptosporangium roseum
Pathway
sro00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Sros_7700
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sros_7700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 Glyco_hydro_2_C Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ACZ90371
UniProt: D2ARN1
LinkDB All DBs
Position
complement(8501289..8503292)
Genome map
AA seq 667 aa AA seqDB search
MGLTRVSGLLFGGDYNPEQWPEHVWDEDVRLMSEAGVTMATVAVFSWSRLEPRPGEYDFG
WLDRVLDLLHEHGVAADLATATATPPPWLVREHPEVLPVDAAGTRLDFGSRQSYCPSSPV
FREATVRLARTMAERYAGHPALAMWHIGNEYADHTLECFCEESARHFRRWLRDRHGSVDG
LNAAWGTSCWGQHYTAFDQVNPPRKAPGPVNPAQVLDWRRFSSDALLECFELEKAVLREV
TPDVPVTTNFMSILHGLDYWKWAAAEDVVSDDAYPDPADPSSHVAVALSYDLMRSLKQRP
WILLEQASSAVSWREVNAPKPPGMMRLHSLQALAHGADGAMFFQWRQAKYGPEKFHSALL
PHGGTASRGWQDTVRLGADLRRLAEIAGSGTHADVALVLDWDSWWGLEAPESMPSDRLRL
KELLQAWYAPMHARGIAVDLVPAGRDLSGYRVVIAPNLYMCTEEQAGHLAAFDGHLVVGP
FSGVVDPADQVHDGGAPGPLRELLGLTVDEFWPLPDGLTQRVRLAPGLRGDGPPAVPART
WAEWLRVEDAEVLARYEGGDLDGQAAITRRGNATYLSCLLDDVTPVLTEVLAAAGVRPVA
DVPEGVEATRRGRYLFLLNHATTPARVDLREPGTDLLTGRDLRGRIDIPPRDAVVLRTGA
EPTEGER
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctgaccagggtttccggtctgctgttcggtggtgactacaaccccgagcagtgg
ccggagcacgtctgggacgaggacgtcaggctgatgtccgaagccggggtcaccatggcg
accgtcgcggtcttctcctggtcccgtctcgaaccgcgcccgggggagtacgacttcggc
tggctggaccgggtcctggacctcctccacgagcacggcgtcgccgccgacctggccacc
gccaccgccaccccgccgccctggctggtgcgcgagcacccggaggtgctcccggtggac
gccgcggggacccgcctcgacttcggctcccgccagagctactgccccagctcgccggtc
ttccgcgaggccacggtacggctggcgcggacgatggccgagcgctacgccggccacccg
gcgctggccatgtggcacatcggcaacgagtacgccgaccacaccctcgaatgcttctgc
gaggagtccgcccgccacttccggcgctggctgcgggaccgccacgggtcggtcgacggc
ctgaacgccgcctggggcacctcctgctggggtcagcactacaccgcgttcgaccaggtc
aacccgccgcgcaaggcgccgggcccggtgaaccccgcccaggtcctcgactggcgccgc
ttcagctccgacgcgctgctggagtgcttcgagctggagaaggccgtgctgcgcgaggtc
accccggacgtcccggtgaccaccaacttcatgagcatcctgcacggcctggactactgg
aagtgggccgcggccgaggacgtcgtcagcgacgacgcctaccccgaccctgccgacccc
tcctcgcacgtggccgtcgcgctcagctacgacctgatgcgctcgctgaagcagcggccg
tggatcctgctggagcaggcgtcgagcgcggtgagctggcgcgaggtcaacgctcccaaa
ccgccggggatgatgcgcctgcacagcctccaggcgctggcccacggcgcggacggcgcg
atgttcttccagtggcggcaggccaagtacggtccggagaagttccactccgcgctgctc
ccgcacggcggcaccgcctcgcgcggctggcaggacacggtacggctcggcgccgacctc
aggcgtctcgccgagatcgccgggtccgggacgcacgccgacgtcgcgctggtcctcgac
tgggacagctggtggggcctggaggctcccgagtcgatgccgtccgaccggctcaggctc
aaggagctcctgcaggcctggtacgcgccgatgcacgcccgcggcatcgcggtggacctc
gtcccggcgggccgcgacctgtccggctaccgcgtggtgatcgcccccaacctctacatg
tgcaccgaggagcaggccggtcacctggccgccttcgacgggcacctcgtcgtcggcccg
ttcagcggcgtcgtcgacccggccgaccaggtccacgacggcggcgcccccggcccgctg
cgcgagctgctcggcctgacggtggacgagttctggccgctccccgacggcctgacccag
cgggtacggctcgcgccggggctgcggggggacgggccgccggccgtaccggcgcggacc
tgggccgaatggctccgcgtcgaggacgccgaggtgctcgcccgttacgagggcggcgac
ctggacgggcaggcggcgatcacccggcgcgggaacgccacctacctgagctgcctgctc
gacgacgtcacccccgtcctgaccgaggtcctggcggccgcgggcgtccggccggtggcc
gacgtgcccgagggcgtggaggccacccgccggggccgctacctcttcctgctcaaccac
gcgacgacccccgcccgggtggacctccgggagccggggaccgacctgctcaccggccgc
gacctgcggggccggatcgacatcccgccccgcgacgccgtggtgctccgcaccggagcc
gagccaaccgaaggagaacggtga

DBGET integrated database retrieval system