KEGG   Streptosporangium roseum: Sros_7969Help
Entry
Sros_7969         CDS       T01137                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
Organism
sro  Streptosporangium roseum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACZ90624
UniProt: D2AVH8
LinkDB All DBs
Position
8780637..8782070
Genome map
AA seq 477 aa AA seqDB search
MRQHDTLFIGGDWVAPAGTGTIDVVSPHTEEVVGRVPDGTPADMDRAVAAARQAFDQGPW
PRMTMAERAAVVGRLAEIYAARQSEMAEIITLEMGSPITFSQMAQAPQPLGMLQYYAELG
RTFPVEEERPGTFGPVTVRREPVGVVAAVVPWNVPQFVIMIKLAPALVAGCTIVVKPAPE
TPLDSYLLAEMVKEAGIPDGVVNIVAAGREAGEHLVSHPGVDKVAFTGSTAAGRRIAAIC
GEQLKRCTLELGGKSAAIILDDCDLPSAMGFLSIASLMNNGQACVAQTRILASRNRYDEV
VDAVATMVRGMPVGDPADPATGIGPLVAKRQQERVQDYIRIGIDEGAKPVVGGLDRPYDR
GWYVAPTVFAGATNEMRIAREEIFGPVLAVIPYEDEADAVRIANDNDYGLAGTVWTADTE
HGMDIARQVRAGTYGVNLYMIESSSPFGGFKSSGLGRELGPEGLSAYLEYKSIARLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagcacgacacgctgttcatcgggggcgactgggtggcccccgcgggcaccggg
accatcgacgtcgtctcgccccacaccgaggaggtcgtcggccgcgtccccgacggcacc
cccgccgacatggaccgcgcggtggccgccgcgcgccaggccttcgaccagggcccctgg
ccccggatgacgatggcggaacgcgccgccgtggtcggcaggctcgccgagatctacgcg
gcccgccagtccgagatggccgagatcatcacgctggagatgggctcccccatcaccttc
tcgcagatggcgcaggcccctcagccgctcggcatgctgcagtactacgccgagctcggc
aggaccttccccgtcgaggaggagcggccgggcaccttcggcccggtgaccgtccgccgc
gagccggtcggcgtggtcgccgccgtggtcccgtggaacgtcccgcagttcgtcatcatg
atcaagctcgcccccgccctcgtcgccggctgcacgatcgtggtgaagcccgcccccgag
accccgctcgactcctacctgctggccgagatggtcaaggaggcgggcatccccgacggc
gtcgtcaacatcgtcgccgccggccgcgaggcgggcgagcacctggtctcccaccccggc
gtggacaaggtcgccttcaccggctccaccgcggccggccgccgcatcgccgcgatctgc
ggcgagcagctcaagcggtgcaccctggagctcggcggcaagtcggccgcgatcatcctg
gacgactgcgacctgccctccgcgatgggtttcctgtcgatcgcctccctgatgaacaac
ggccaggcctgtgtcgcccagacacgcatcctggcctcgcgcaaccgctacgacgaggtc
gtggacgcggtcgccacgatggtccgcggcatgccggtcggcgaccccgccgaccccgcc
accggcatcggcccgctggtcgccaagcgacagcaggagcgggtccaggactacatcagg
atcggcatcgacgagggcgccaagccggtcgtcggcggcctggaccgcccctacgaccgg
ggctggtatgtcgctccgaccgtcttcgccggggccaccaacgagatgcgcatcgcccgc
gaggagatcttcggcccggtcctggcggtgatcccctacgaggacgaggccgacgcggtc
cgcatcgccaacgacaacgactacggactggccgggacggtgtggaccgccgacaccgag
cacggcatggacatcgcccgccaggtgcgcgccggcacctacggggtcaacctctacatg
atcgagtccagctccccgttcggcggcttcaagagcagcggcctcggccgcgaactcggc
cccgagggcctgtcggcctacctggagtacaagtcgatcgcccgcctgggctga

DBGET integrated database retrieval system