KEGG   Streptosporangium roseum: Sros_8141Help
Entry
Sros_8141         CDS       T01137                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00500  Starch and sucrose metabolism
sro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sros_8141
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Sros_8141
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Sros_8141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase GHL5
Motif
Other DBs
NCBI-ProteinID: ACZ90796
UniProt: D2AX69
LinkDB All DBs
Position
8977185..8978888
Genome map
AA seq 567 aa AA seqDB search
MSQLPEPIPNTFDEEKPRDPYWFKRAVFYEVLIRGFADSNGDGTGDIRGLIDKLDYLQWL
GVDCLWLLPLYESPLRDGGYDIADFMKILPEFGDLGDFVKLVDEAHKRGMRVIADLVMNH
TSDQHPWFQASRHDPEGPFGDFYVWSDSDELYKDARVIFIDTETSNWSHDPVRGQYYWHR
FFSHQPDLNYENPDVQDAMLEVLRFWLDLGIDGFRMDAIPYLFEQDGTNCENLPRTHEYL
KRVRAEVDRLYPDRVLLAEANQWPADVVEYFGDPATGGDECHMAFHFPLMPRIFMAVRRE
SRYPISEIMAQTPKIPENCQWGIFLRNHDELTLEMVTDDERDYMYSEYAKDPRMRANVGI
RRRLAPLLENDRNQIELFTALLLSLPGSPVLYYGDEIGMGDNIWLGDRDGVRTPMQWSPD
RNAGFSDCDPARLYLPVIMDPIYGYQAINVEAQQKSSGSLLHWTKRMIDIRKRHPVFGLG
AFTELNSSNPSVLAYVREYGDDRILCVNNLSRFPQPVELDLRRFEGSVPVETMGGVPFPP
IGELPYLLTLPGHGFYWFTLPPVTQEA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagctacctgagccaattccgaacaccttcgacgaggagaagccgcgcgatccg
tactggttcaagcgcgctgttttctacgaggtgctcatccggggtttcgccgattccaac
ggggacggcaccggagacatccgcggcctcatcgacaaactggactatctccagtggctc
ggcgtggactgcctctggctgctgcccctgtacgaatcgccgctccgcgatggcggctac
gacatcgcggacttcatgaagatcctccccgagttcggtgatctcggagatttcgtcaag
ctggtggacgaagcccacaagcggggcatgcgcgtcatcgccgacctggtgatgaaccac
accagcgaccagcacccctggttccaggcctcccgccacgaccccgagggcccgttcggc
gacttctacgtctggagcgactccgacgagctctacaaggacgcccgggtcatcttcatc
gacaccgagacgtccaactggtcccacgacccggtgcggggccagtactactggcacagg
ttcttctcccaccagccggacctcaactacgagaacccggacgtgcaggacgcgatgctg
gaggtgctgcggttctggctggacctgggcatcgacgggttccggatggacgccatcccc
tacctgttcgagcaggacggcacgaactgcgagaacctgcccaggacccacgaatacctg
aagcgggtcagggccgaggtcgaccgcctctaccccgaccgggtgctgctggccgaggcc
aaccagtggccggcggacgtggtggagtacttcggcgacccggcgaccggcggcgacgag
tgccacatggcgttccacttcccgctgatgccgcgcatcttcatggccgtcaggcgggag
tcccgctacccgatctcggagatcatggcccagacgccgaagatccccgagaactgccag
tggggcatcttcctgcgcaaccacgacgagctcacgcttgagatggtgaccgacgacgag
cgcgactacatgtactcggagtacgccaaggacccccggatgcgggccaacgtcggcatc
cggcggcggctggccccgctgctggagaacgaccgcaaccagatcgagctgttcaccgcg
ctgctgctctcgctgcccggttccccggtgctctactacggcgacgagatcgggatgggc
gacaacatctggctgggcgaccgcgacggcgtccgcactccgatgcagtggagccccgac
cgcaacgccgggttctccgactgcgaccccgcccggctctacctgccggtcatcatggac
ccgatctacggctatcaggcgatcaacgtcgaggcgcagcagaagagctccggctcgctg
ctgcactggaccaagcggatgatcgacatccgcaagcgccacccggtcttcggcctgggg
gcgttcaccgagctgaactcctccaacccgagcgtcctcgcctacgtgcgcgagtacggc
gacgaccgcatcctgtgcgtcaacaacctgtcgcggttcccgcagccggtggagctggac
ctgcgccggttcgagggatcggtgcccgtcgagaccatgggcggagtaccgttcccaccg
attggcgaacttccgtatcttttgacgcttcctgggcatgggttctattggttcaccctg
ccacccgtaacccaggaggcgtaa

DBGET integrated database retrieval system