KEGG   Streptosporangium roseum: Sros_8301Help
Entry
Sros_8301         CDS       T01137                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sro  Streptosporangium roseum
Brite
KEGG Orthology (KO) [BR:sro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sros_8301
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sros_8301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ACZ90949
UniProt: D2AZ12
LinkDB All DBs
Position
9164192..9164593
Genome map
AA seq 133 aa AA seqDB search
MLARLLRPKHVASAHCDLPCGVYDPAQARIEAESVKAIMEKYAANEDPVFRSRALTIKEE
RSELVKHHLWVLWTDYFKPPHLETYPQLHQLFWDATKLAGAAGGKGTVDVAKADELLGKI
DEISKIFWATKAA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcacgacttctgcgacccaagcacgtcgcgtccgcgcactgcgacctgccgtgt
ggcgtgtacgaccccgcccaggctcgcatcgaggccgagtccgtgaaggccatcatggag
aagtacgcggcgaacgaggacccggtcttccgttcccgcgcgctcaccatcaaggaggag
cggtcagagctggtcaagcaccacctgtgggtgctgtggaccgactacttcaagcctccg
cacctggagacctacccgcagctgcaccagctcttctgggacgcgacgaagctggccggc
gccgcgggcggcaagggcaccgtcgacgtcgcgaaggccgacgagctcctgggcaagatc
gacgagatctccaagatcttctgggcgaccaaggctgcctga

DBGET integrated database retrieval system