KEGG   Streptosporangium roseum: Sros_8745Help
Entry
Sros_8745         CDS       T01137                                 

Definition
(GenBank) heme peroxidase
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00590  Arachidonic acid metabolism
sro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Sros_8745
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     Sros_8745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-ProteinID: ACZ91381
UniProt: D2B5S7
LinkDB All DBs
Position
9646656..9648242
Genome map
AA seq 528 aa AA seqDB search
MAPSRARARSIATDGAANRLRFLALTSGRPLWDLAQRVQPVRRHLNASLIDHAVREMPPR
PEPLSTMADYTSWASLTDRTFSGRHMPPVSGPEGGRPTPEQAADLFTRGDAMIPCPRSTV
LFAYFAQWFTDGFLRGDTHVPRDPRKNSSNHHIDLNQLYGLDEAATAALRTFDGGLLKSR
LVNGAEFPPKLCENGKIKDEFSALSVIRFDELTDAQRDTLFATGSDRGNIQLGFTMLTVL
FLREHNRVARLLAGHYPRWDDERLFQTARNILIVLLIKLVVEEYINHITPYHFRFALDPR
LSTMLARAPWHRENWASAEFNLVYRWHSLIPSKLAVGDRELPMAETLVGGALIPGPGLGR
LFEDASRQRAGRIGLFNTDPVLRAVDVASVAESRALKLAPYNSYREHCRFPRVRRFDQVS
GDARVSEALGELYRNVDDLDLYVGLFAEEPGAPNAMLPPLLTKIIAIDAFSQALTNPLLA
SRVFNAATFSPHGMKVIATTRTLSDVLHRNVPEDPRPRFVSMTRQGAR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtggcacccagcagagcgcgggcgcgaagcatcgcgaccgacggcgccgccaaccgcctc
aggttcctggccctgaccagcggacgtccgctgtgggacctcgcccagcgcgtccagccc
gtacggcggcacctcaacgcctcgctgatcgaccacgcggtccgcgagatgccaccacgg
cccgagccgctgagcaccatggccgactacacctcgtgggcctcgctgaccgatcggacg
ttcagcgggcgtcacatgccgccggtctccggacccgagggcggccggcccacccccgaa
caggccgccgacctgttcacccggggtgacgccatgatcccgtgtccccggtccaccgtg
ctgttcgcctacttcgcccagtggttcaccgacgggttcctccgcggcgacacccacgtc
cccagggatccgcgtaagaacagctcgaaccaccacatcgacctgaaccagctctacggg
ctcgacgaggcggcgaccgccgccctccggacgttcgacggcggactgctcaagagccgg
ctcgtcaacggcgcggagttccctcccaagctctgcgagaacggcaagatcaaagacgag
ttctccgcgctgagcgtgatccgtttcgacgagctcaccgacgcgcagcgcgacaccctg
ttcgcgacgggcagcgaccgcggcaacatccagctcggtttcaccatgctcacggtgctg
ttcctgcgcgagcacaacagggtggcgcgcctgctggcaggccactatccgcgctgggac
gacgagcgcctgttccagacggcgcgcaacatcctcatcgtgctcctcatcaaactggtg
gtggaggagtacatcaaccacatcacgccctaccacttccgcttcgccctggatccgcgg
ctctccaccatgctggcccgcgcgccctggcaccgggagaactgggcctcggcggagttc
aacctcgtctaccgctggcacagcctgatcccctccaaactggccgtgggcgaccgggag
cttccgatggcggagaccctggtcggtggagcgctcatccccgggccgggcctgggccgg
ctcttcgaggacgcctcccggcagcgcgcggggcgcatcggcctgttcaacaccgacccc
gtgctgcgggcggtcgacgtggccagcgtcgccgaatcgcgggccctgaagctggccccc
tacaacagctaccgtgagcactgccgcttcccccgcgtgcgccgcttcgaccaggtctcc
ggtgacgcgagggtgagcgaggcgctcggcgagctctaccggaacgtggacgacctggat
ctgtacgtcggcctgttcgccgaggagccgggcgccccgaacgccatgctgccgccgctc
ctgacgaagatcatcgccattgacgccttctcgcaggcgctgaccaatccgctgctggcg
tcgcgggtgttcaacgccgcgaccttctccccgcacgggatgaaggtcatcgccaccacg
cgaacactgtcggacgtgctccaccgcaacgtcccggaggacccgcgaccgcgtttcgtg
agcatgacccggcagggagcgcggtga

DBGET integrated database retrieval system