KEGG   Streptosporangium roseum: Sros_8808Help
Entry
Sros_8808         CDS       T01137                                 

Definition
(GenBank) alpha amylase, catalytic region
Organism
sro  Streptosporangium roseum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACZ91443
UniProt: D2B5Y9
LinkDB All DBs
Position
complement(9715327..9716985)
Genome map
AA seq 552 aa AA seqDB search
MRLTYTADLWWKNAVVYCLDVETYKDGNGDGIGDFRGLTQQIDHLDRLGVTCIWLMPFFP
TPNRDDGYDITDFYSVDPRLGTLGDFVEFMRTARDRGIRVIADLVVNHTSDEHPWFKEAR
SSRDSAKRDWYIWKDDPDPVDPKDLVFPDKEDSIWELDEKTGQYYLHSFYRFQPDLNVAN
PEVRDEIARVLGFWMELGLSGFRVDAVPFLIEGIGPDPHEFLADLRAFMNRRDGTSILLG
EVNLPYPDLMEYFGDGNGDQVTMCFDFIGMQRFHLSMARQNPQALAESLRERPAPPDDSH
WATFVRNHDELTLDKLTEAEKHEVFDAFGPDKDMQVYDRGLRRRLPPMLGGDQRRLKLAY
SVLFSLPGTPVLFYGEEIGLGENLEAEGRMAVRIPMQWSRSGGFSPDPKTAVPTPEGEYG
PRHVNVDDQRRDPDSMLKWITMLVERYRESPELAWGRYEVLDAGDEAVLAHRADAEGGTV
IAVHNFADREAEVELVLRDLDHCEVLTDLLVDGTLDLPSDGRVKFALEPYGTRWLRAAVP
DAPLGNSSAKSH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgacctacacagctgacctgtggtggaagaacgcggttgtctactgcctggac
gtcgagacctacaaggacggcaacggcgacggcatcggggacttccgcgggctcacccag
cagatcgaccacctggaccggctcggggtgacctgcatctggctgatgccgttcttcccg
acgcccaaccgtgacgacggctacgacatcaccgacttctactccgtcgacccccggctg
ggcaccctcggcgacttcgtggagttcatgcgcaccgccagggaccggggcatccgggtg
atcgccgacttggtggtcaaccacacctccgacgagcacccctggttcaaggaggcgcgc
tccagccgggactccgccaagcgggactggtacatctggaaggacgaccccgaccccgtc
gaccccaaggacctcgtcttccctgacaaggaggacagcatctgggaactggacgagaag
acgggccagtactacctgcacagcttctaccgcttccagcccgacctgaacgtggcgaac
cccgaggtccgcgacgagatcgcgcgcgtcctcggattctggatggagttggggctgtcc
ggcttccgggtggacgcggtgccgttcctgatcgagggcatcggccccgatccgcacgag
ttcctcgccgacctgcgcgccttcatgaaccgccgcgacggcacctcgatcctgctgggc
gaggtcaacctgccctatccggacctgatggagtacttcggcgacggcaacggcgaccag
gtcaccatgtgcttcgacttcatcggcatgcagcggttccacctgtcgatggcccggcag
aacccgcaggcgctcgccgagtccctccgcgagcgccccgccccgcccgacgactcccac
tgggccaccttcgtccgcaaccacgacgagctgaccctggacaagctcaccgaagccgag
aagcacgaggtcttcgacgctttcggcccggacaaggacatgcaggtctacgaccggggc
ctgcgccgccgcctgcccccgatgctcggcggagaccagcgccgtctcaagttggcctac
agcgtcctgttctccctgccgggcacgccggtgctcttctacggagaggagatcggtctc
ggtgagaaccttgaggccgagggacggatggcggtccggatcccgatgcagtggtcccgc
tccggcggcttctcacccgacccgaagaccgccgtgccgacccctgaaggtgagtacggc
ccgcggcacgtcaacgtggacgaccagcgccgcgaccccgactcgatgctcaaatggatc
accatgctggtcgagcgctaccgggagtcgccggagctcgcctggggccggtacgaggtg
ctggacgccggggacgaggccgtactggcccaccgggccgatgccgagggcggcaccgtg
atcgccgtccacaacttcgccgatcgggaggcggaggtggagctcgtgctgcgcgatctc
gaccactgcgaggtgctgaccgacctgctggtggacggcaccctcgatctgccctccgac
ggccgggtgaagttcgcccttgagccgtacggcacccgctggctgcgcgcggccgtcccc
gacgcgcccctggggaacagctcggccaagagccactag

DBGET integrated database retrieval system