KEGG   Streptosporangium roseum: Sros_9380Help
Entry
Sros_9380         CDS       T01137                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sro  Streptosporangium roseum
Pathway
sro00473  D-Alanine metabolism
sro00550  Peptidoglycan biosynthesis
sro01100  Metabolic pathways
sro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sros_9380
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sros_9380
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sros_9380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sro01011]
    Sros_9380
Enzymes [BR:sro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sros_9380
Peptidoglycan biosynthesis and degradation proteins [BR:sro01011]
 Precursor biosynthesis
  Amino acid ligase
   Sros_9380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACZ91998
UniProt: D2BEG1
LinkDB All DBs
Position
10331137..10332093
Genome map
AA seq 318 aa AA seqDB search
MSDLGYVLVLAGGLSYEREVSLRSGRRVSEVLRTAGIVVETRDTDASLVPSILADPPDAV
FVTLHGGAGEDGAIRSVLELLSVPYVGAGPDACRVAFDKPTAKTVVRSVGLRTPDSVTLP
KETFHDLGASTVLTRIVERLGLPLFVKPSRGGSALGASIVRAAEDLPAAMVGCFAYGDTA
LIERCIEGVEVAVSVVDLGGGPMALPPVEIVPDKGVYDYAARYTAGHTEFFAPARLSPEA
AAACAEMAVTAHTALGLRDISRTDLIVDGDGLPHFLEVNVAPGMTETSLLPMAVEAAGDD
LGTLCRVLLEQAAARGAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatctgggctacgtgctcgtcctggcaggcggactgtcttacgagcgggaggtg
tccctccgctccggccgccgggtgagcgaggtgctgcgcacggcggggatcgtcgtggag
acccgtgacaccgacgcctcgctcgtgccctccatactcgccgacccgccggacgcggtc
ttcgtcacccttcacggcggggccggtgaggacggcgccatccgctcggtgctcgaactc
ctctccgtcccctatgtcggcgccggccccgacgcctgccgggtggccttcgacaagccc
accgccaagacggtcgtccgctccgtcgggctgcgcacccccgactcggtgacgctcccc
aaggagaccttccacgacctcggcgcctccacggtgctgacccgcatcgtggagcgcctc
ggtctccccctgttcgtcaagccctcccgcggcggctccgcgctcggcgcgtcgatcgtc
cgtgccgccgaggacctccccgccgccatggtcggctgcttcgcctacggtgacaccgcg
ctgatcgaacgctgcatcgagggtgtcgaggtggccgtctccgtggtcgatctcggcggc
ggcccgatggccctgccccccgtggagatcgttcccgacaagggcgtctatgactacgcg
gcccgctacaccgccggccacaccgagttcttcgccccagcccgcctgtcccccgaggcc
gccgccgcctgcgccgagatggccgtgaccgcgcacaccgccctcggcctccgtgacatc
tcccgcaccgacctcatcgtcgacggggacggcctcccccatttccttgaggtcaacgtc
gcccccggcatgaccgagacctcccttctcccgatggccgtcgaggccgccggcgacgac
ctcggcaccctctgccgcgtcctgctggagcaggccgccgcccgcggcgccgcctga

DBGET integrated database retrieval system