KEGG   Streptococcus suis ST1 (serotype 1): SSUST1_0353Help
Entry
SSUST1_0353       CDS       T02125                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
srp  Streptococcus suis ST1 (serotype 1)
Pathway
srp00220  Arginine biosynthesis
srp00250  Alanine, aspartate and glutamate metabolism
srp00290  Valine, leucine and isoleucine biosynthesis
srp01100  Metabolic pathways
srp01110  Biosynthesis of secondary metabolites
srp01130  Biosynthesis of antibiotics
srp01210  2-Oxocarboxylic acid metabolism
srp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSUST1_0353
   00290 Valine, leucine and isoleucine biosynthesis
    SSUST1_0353
   00220 Arginine biosynthesis
    SSUST1_0353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srp01007]
    SSUST1_0353
Enzymes [BR:srp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SSUST1_0353
    2.6.1.66  valine---pyruvate transaminase
     SSUST1_0353
Amino acid related enzymes [BR:srp01007]
 Aminotransferase (transaminase)
  Class I
   SSUST1_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AER20766
UniProt: G7SJ41
LinkDB All DBs
Position
351429..352643
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEAAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILEGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVDDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtgttggtgccaatgccagactatcctctctggactgccgcagttagtttggctggt
ggtaaagctgttcattatgtttgtgatgaagcagctgaatggtatccagatttggcagac
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttagaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgacggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcgcatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgaactcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccagggctttctgctgtaaaacctaaggctggtctgtatgtcttcccaaaaattgatcgt
gagatgtacagagttgatgatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgttgatgagttggcagaaattcaagaaaaaatgtcacgattcttacgg
caatatcgtagataa

DBGET integrated database retrieval system