KEGG   Streptococcus suis ST1 (serotype 1): SSUST1_0528Help
Entry
SSUST1_0528       CDS       T02125                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srp  Streptococcus suis ST1 (serotype 1)
Pathway
srp00620  Pyruvate metabolism
srp00680  Methane metabolism
srp01100  Metabolic pathways
srp01120  Microbial metabolism in diverse environments
srp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUST1_0528
  09102 Energy metabolism
   00680 Methane metabolism
    SSUST1_0528
Enzymes [BR:srp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SSUST1_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RasGEF
Motif
Other DBs
NCBI-ProteinID: AER20926
UniProt: G7SL08
LinkDB All DBs
Position
528604..531300
Genome map
AA seq 898 aa AA seqDB search
MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVELSQLSRQDDYQALIAI
ISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNIDQDYLGKISTTIDMVSKQE
NAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRRYRDVKLGLLNKNKWEDELRC
YIEIIMQTDMIREKKLKVTNEITNVMEYYNSSLIKAVTKLQREYKRLAAEKGIVLNNPRP
ITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNYYDDQLYKLYRNFSLSTSIVNVSTA
VKMLADLSEDSSVYRENEPYRRAFHYIQMKLANTRDYLVHNKPSDVRYSNVAEFKADLLA
IKQSLIENKSMALLKGDFTELLEAVEAFGFYLASIDMRQDSSIHEASVAELLASARIVED
YSSLSEEAKCHVLLKQLETDPRILSATHMPKSEQLEKELAIFAAARELKDKLGEEIIKQH
IISHSESVSDLLELAVLLKEVGLVDVDKARVQIVPLFETIEDLDNAPDTMRQYLQLDLAK
RWIAGNKYYQEIMLGYSDSNKDGGYLSSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTV
GRGGGPSYDAITSQPFGSIKDRLRLTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQ
MITDPNEIDGYRETMDEIVSDSYRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAA
RKTITEIGGLRAIPWVFSWSQNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFF
RSLLSNVDMVLSKSNMNIAFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLA
ELPFLKASLDYRMPYFNVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaaattggaaaactataacaacaaggaagcaatccgtgaagaagtaacg
attctaacatctattttggaagaagtagcagcccaaatgatgcctgcagagacttttgct
aaaattgtagaattatcacaattgtctcgtcaagatgattatcaggcattgattgctatt
atcagtcagttgaataatgatgaactagcagttatttctcgatactttgctgttttgcca
cttttgattaatatatcagaagatgttgatttggcctatgaaatcaatcaccaaaacaat
attgatcaagattatcttggtaagatttcaacaacaattgatatggtttccaaacaagaa
aatgcagctgaaatccttgaaaagttgaatgttgttccagtcttgacagcccatcctact
caggttcaacgccagtctatgctggatttaaccaagcatattcatgagttgcttcgtcgt
tatcgcgatgtaaaattgggcttgctcaataaaaacaaatgggaagatgagctccgttgt
tacattgaaattatcatgcagacggatatgattcgtgagaagaagttgaaggtaaccaac
gaaatcacaaacgttatggagtattacaattcttcccttattaaggctgtcactaagttg
cagcgggaatacaaacgtttggccgctgagaaaggaatcgtcttaaataatcctcgtcca
attacaatgggtatgtggattgggggagaccgtgatggaaatccatttgttactgcagag
accttgaagctgtcagccttgactcagtgtgaagtcattatgaattattacgatgatcaa
ctctataaactctatcggaatttttcgctctcaacttccattgtaaatgtatctacagcg
gttaagatgctggcggatttatctgaagatagttctgtctaccgtgaaaatgagccttat
cgtcgtgcttttcactatattcagatgaaacttgcaaatacaagagattatctagttcac
aataagccgtcagatgttcgctatagtaatgtagccgagtttaaagctgatttattagcc
atcaaacaatctttgattgaaaataaatctatggcgctattgaaaggtgattttacagaa
ttgcttgaagcggttgaagcgtttggtttctacctagctagtatcgatatgcgccaagac
tcttctattcatgaagcaagtgttgcggaactattggcttctgcccgtatcgtagaagac
tactccagtttatctgaggaagctaaatgccatgttcttttgaaacagttggaaacagat
ccacgcattctttctgcaacgcacatgccaaagtcagaacaattagaaaaagaattggcc
atctttgctgctgcgcgtgaattgaaagataagctaggtgaggaaatcatcaagcaacat
attatttcacactcggagagtgtttctgatttactggaattagctgtcctactaaaagaa
gttggtctagtagatgtcgataaggcccgtgttcagattgttccactttttgagacaatc
gaggacttagataatgcacctgataccatgcgtcaatatctgcaattagatttagcgaaa
cgttggattgcaggcaataaatactaccaagaaatcatgctaggctactcagattccaac
aaggatggtggctacctatcctctggctggacactctacaaagcacagaatgaattgacg
caaattggtcaagactacggagtaaacatcaccttcttccacggtcgtggaggtactgtt
ggtcgtggtggtggtccttcctatgatgcgattacatctcagccatttggttctatcaag
gaccggcttcgtttgacagaacaaggcgaagtgataggcaataaatacggtaacaaagac
gcagcctactataatttagaaatgctggtatctgcaacgcttgaccgtatggtcacacaa
atgattaccgatccaaatgaaatcgatggctatcgcgaaaccatggatgaaattgtatca
gatagctatcgtatttatagagatcttgtgttcaataatccacatttttatgattatttc
tttgccgctagtccaattcgtgaagtatcaagtctgaacattggctcacgtcctgcggct
cgaaaaaccatcacagaaatcggtggtttgcgtgcgattccatgggtattctcctggtca
caaaaccgtgttatgttgccaggttggtatggagttggttcaagtttcaaacgctttatt
gataagcaccctgataatttgtctaagttacaaaaaatgtacgaatcttggccattcttc
cgttcacttctatcaaacgtggatatggtattgtctaaatccaatatgaatatcgcattt
gaatatgctaaaatgtgtgaaagcgaagaggtacgaaatatcttccatgtcattttagat
gaatggcagttgaccaaagaaattattttgtcaatcgagcaaaatgatgagcttttagca
gaactaccgtttctaaaagctagtcttgactatcgcatgccttatttcaatgtgctcaac
tatattcagattgaattaattcatcgtcttcgtcgtggagaattgagcaaagaacaagag
aatctcattcatattaccatcaatggtgtggcgacaggtttgcgcaactcaggttaa

DBGET integrated database retrieval system