KEGG   Streptococcus suis ST1 (serotype 1): SSUST1_1420Help
Entry
SSUST1_1420       CDS       T02125                                 

Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
srp  Streptococcus suis ST1 (serotype 1)
Brite
Enzymes [BR:srp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SSUST1_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TGF_beta_GS
Motif
Other DBs
NCBI-ProteinID: AER21772
UniProt: G7SJI7
LinkDB All DBs
Position
complement(1397893..1398498)
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDV
EQIPADIRQALINNGGGHLNHALFWELLSPEKTEISAELAADIDATFGSFDAFKEAFTAA
ATTRFGSGWAFLVVNKEGKLEVISTANQDTPIMQGLKPILALDVWEHAYYLNYRNVRPNY
IKAFFEVINWDKVNELYKAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagaccttccatacgcatacgatgccttggaaccacatattgat
gcagaaacaatgacccttcaccacgataagcaccatgcgacttatgttgcaaatgctaat
gcagcacttgaaaaacatcctgaaattggcgaagacttggtagctcttttgtcagatgtg
gagcaaattccagctgacatccgccaagctttgatcaacaacggtggtggtcatttgaac
catgctcttttctgggaattgctttcacctgaaaaaacagaaatttcagcagaattggca
gcagatattgatgcaacctttggttcatttgatgctttcaaagaagccttcactgcagca
gcaacaactcgtttcggttcaggttgggctttcttggttgttaataaagaaggcaagttg
gaagttatctcaactgctaaccaagacacaccaatcatgcaaggtttgaaaccaatcttg
gcattggacgtttgggaacatgcttactaccttaactaccgcaatgtccgtccgaactac
atcaaagccttctttgaagtaatcaactgggacaaggttaacgaactttataaagcagct
aaataa

DBGET integrated database retrieval system