KEGG   Streptococcus suis ST1 (serotype 1): SSUST1_1724Help
Entry
SSUST1_1724       CDS       T02125                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
srp  Streptococcus suis ST1 (serotype 1)
Pathway
srp00010  Glycolysis / Gluconeogenesis
srp00020  Citrate cycle (TCA cycle)
srp00620  Pyruvate metabolism
srp01100  Metabolic pathways
srp01110  Biosynthesis of secondary metabolites
srp01120  Microbial metabolism in diverse environments
srp01130  Biosynthesis of antibiotics
srp01200  Carbon metabolism
Module
srp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:srp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST1_1724
   00020 Citrate cycle (TCA cycle)
    SSUST1_1724
   00620 Pyruvate metabolism
    SSUST1_1724
Enzymes [BR:srp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSUST1_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AER22071
UniProt: G7SN39
LinkDB All DBs
Position
complement(1668408..1669796)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GGGKVRATPAARKLARELGIDLGLVPGTGAKGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPAAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggtgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgcagaaggt
gaaacggttgaagccggggcttcatctgctcctgctgttgagccagctgcagcgattgaa
gaagtgccagcaggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtggtggcaaggttcgtgcgactccagctgcgcgtaaattggcgcgtgagcttggaatt
gacttgggtcttgttccaggaacaggtgctaaaggtcgtgtccacaaggttgatgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcggaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaatgac
gttcttgcagtacttgctccggctgctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgactaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcagttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgctcaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaacagttcaaacaccagttgttatcgacggcgaa
atcaagatccgtccaatcatggcactctgcttgaccatcgaccaccgtatcattgatggt
atgaacggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatttaa

DBGET integrated database retrieval system