KEGG   Streptococcus ruminantium: SR187_1170Help
Entry
SR187_1170        CDS       T05916                                 

Definition
(GenBank) hypothetical protein
Organism
srq  Streptococcus ruminantium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADIP ATG16 CENP-F_leu_zip Filament Spc7 Fez1 DUF3450 Sec34 Pox_A_type_inc FlxA APG6_N Gram_pos_anchor BAG6 HOOK DUF4201 Myosin_tail_1
Motif
Other DBs
NCBI-ProteinID: BBA91865
UniProt: A0A2Z5TN03
LinkDB All DBs
Position
complement(204120..206045)
Genome map
AA seq 641 aa AA seqDB search
MLANNHQNTHNERNKVISKDEAASNLAKVIVDKEVDKNDEVKKKITDAISKLKPETLREL
YKDGGIDFLGVLVSGDREALQKLRQMVLEDIGKRFADGKLGEIPENYERIKQELEELKKQ
AENFDKLRDDFKHKFEEAQKEKTELENKIKQLEQGKKDLESLREELREDLELFKQKDQDG
LRKRIVDLQEQLQKQKEETQQKIGELEQQLSEAKQKIEEAQGESIKIHQEKSELEAKKED
LQKQLDELKKKLDSTTQENDKLKEERQRLIDENTELLKKLSDSEHQLDKLKEEKEKLEKE
QKNLEKLLKESGKSDLIKKNLELTEEVDRLKKEKANLEQELAKAKQELEKLRQGKQEDQS
EKEKQLEAEVQRLTKELIDKENKLTERAQQLAESQEKVNKLEADKEALSKQIEDLKKQLA
DLEDKIKTLEADKEALSKQVEDLKKQLAESEGKVKTLEADKEKLNKQVEDLKKQLAERKP
QTPDTDPSRPQVPEVKPQRPQVPDTDPSRPHVPDVDPHSPKVPDVDPQHRPHVPDTDPQR
SPKSKEEMSPREDKPMVKPEGTPKPGGKKTEILPVPSHKRHPEATEKVQGETKRPAPRQM
ASKAQAKTLPNTGDAPSMLAWLGSGLLGLLGVSRMNRRNKK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcgaataatcatcaaaatacgcacaatgaacgaaataaagttatttctaaggat
gaggcagcaagtaatctagctaaggtaatagttgacaaagaagttgataaaaatgatgaa
gtaaagaaaaaaattacagatgctatttccaagttgaagccggaaacattacgtgagctt
tataaggatggaggaattgattttctcggtgttctagtaagtggtgatcgtgaagctttg
cagaaacttcgccagatggtccttgaagatattggtaagagatttgctgatggtaaacta
ggtgaaatacctgagaactacgagcgaattaaacaagagcttgaagagcttaaaaaacaa
gcagaaaattttgataaactacgtgatgattttaaacataagttcgaagaagctcaaaaa
gaaaaaacagagcttgagaacaaaatcaagcagctcgaacaagggaaaaaagatttggaa
tctcttcgtgaagaattgagggaagatttagaactatttaaacaaaaggatcaggatgga
ctaagaaaacgcatagtagatttacaagaacaattacagaaacagaaagaagagactcaa
caaaagattggtgaactagaacaacaactatccgaagccaaacaaaaaattgaggaggct
cagggtgaatctataaaaattcatcaagaaaagagtgaattagaagctaaaaaagaagac
ttgcaaaaacaattagacgaattaaagaaaaaacttgattcaaccactcaggaaaatgat
aaactcaaggaagaaagacaacgacttattgatgaaaatactgagctcctgaaaaaatta
tcagattcagaacaccaacttgacaaactcaaggaagaaaaagaaaaactagaaaaagag
cagaaaaatcttgaaaaactcttgaaagaaagcggcaaatccgaccttatcaagaaaaac
cttgaattgacagaggaagttgatcgcttgaagaaagagaaagcaaatctggagcaagag
ttggccaaggctaagcaagagctagaaaaattgcgccaaggcaaacaagaagatcagtct
gagaaagagaagcagctagaagctgaggtacaacgtctcacgaaggaactgattgacaag
gaaaataaactcactgaaagagctcaacaactcgcagagagccaagaaaaagtcaataaa
ctcgaagcggataaggaagctctcagcaagcaaattgaagaccttaagaaacagttggca
gacttggaagacaagattaagacactcgaagcggataaggaagctctcagcaaacaagtt
gaagaccttaagaaacaactggcagagtctgaaggtaaagttaagacacttgaagcagat
aaggaaaaactcaacaaacaagttgaagaccttaagaaacagttggcagagagaaaacct
cagactccagatactgacccaagtcgtcctcaagtgccagaggtgaaacctcaacgccct
caagtgccagacactgacccaagtcgtcctcatgtaccagatgtagatccacactctcct
aaggtgccggatgtggacccacaacaccgtcctcatgtaccggacactgatccacaacgc
tcaccaaaatcaaaagaagaaatgtctccacgtgaagataagccaatggtaaaacctgaa
ggtacaccaaaaccaggtggtaagaaaactgaaatccttccagtaccaagccataagaga
catccagaggcaactgaaaaagtgcagggagagaccaaacgtccagcaccaagacaaatg
gcttctaaagcccaagctaagaccttgccaaatacaggtgatgcaccatctatgcttgca
tggctgggaagtggcttgctaggactcctaggcgtaagccgcatgaacagaagaaacaaa
aaataa

DBGET integrated database retrieval system