KEGG   Serratia plymuthica AS9: SerAS9_0227Help
Entry
SerAS9_0227       CDS       T01503                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
srr  Serratia plymuthica AS9
Brite
Translation factors [BR:srr03012]
 Eukaryotic Type
  Elongation factors
   SerAS9_0227
 Prokaryotic Type
   SerAS9_0227
Mitochondrial biogenesis [BR:srr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SerAS9_0227
Exosome [BR:srr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SerAS9_0227
  Exosomal proteins of breast cancer cells
   SerAS9_0227
  Exosomal proteins of colorectal cancer cells
   SerAS9_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AEF43389
LinkDB All DBs
Position
263115..264299
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALE
GEPEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFDSEVYILSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgactgcagcaatcaccaccgttctggctaaaacctac
ggcggttctgcacgtgctttcgaccagatcgataacgcgccagaagaaaaagctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccaagccgtcactacgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcaatcctggttgttgctgcgactgacggcccaatgcctcagacccgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtattcatgaacaaatgcgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagttcgtgaacttctgtctgct
tacgacttccctggtgatgacctgccggttgttcgtggttcagcgctgaaagcactggaa
ggcgaacctgagtgggaagctaaaatcatcgagttggccggtttcctggattcttacatc
ccagaaccagagcgtgctatcgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcgttaaagttggc
gaagaagttgaaatcgtgggtatcaaagacaccgttaagtctacctgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtgggtgttctgctgcgt
ggtatcaagcgcgaagatatcgaacgtggtcaggtcctggctaaaccaggttcaatcaag
ccacacaccaagtttgactcagaagtgtacatcctgagcaaagaagaaggtggtcgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggtgacaacgtgaacatggtt
gttaccctgatccacccaatcgcgatggacgacggcctgcgtttcgcaatccgtgaaggc
ggccgtactgttggcgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system