KEGG   Serratia plymuthica AS9: SerAS9_0300
Entry
SerAS9_0300       CDS       T01503                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4710 family
Organism
srr  Serratia plymuthica AS9
SSDB
Motif
Pfam: TraU DUF5473
Other DBs
NCBI-ProteinID: AEF43462
LinkDB
Position
347045..348052
AA seq 335 aa
MQRPLLHGMPPEQPRLTLKSLSVAIMLTAASVPAANAALNSAQIVASAVSQACISWRVSG
ICYWLLCTPFGCKVRTSVKVTHYIPEAVVSAYNTQGGNPWREMSMVSQAAGGLESSITSG
LSGVSAGGGNNELKTPGERKTNLHFKYADAIGHPATSLIGGSIAGYSCRSAATPFVPYFL
STLDSLAWRTGIPESLYPEALVPGMREVGSQAAANMWGNVYPRSGFVTQVDDDKAGALVA
QRVADIITRSGQPHVYQLLMGQRSEGYWPPGAVTENTGTNNHKWQRLAPQLSQSCAVFPD
GDHPPAADANAAFALWQPYSCCQRRGQRFLSSTDF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcagcgaccccttttgcatgggatgcccccggaacaaccccgccttacccttaaatcc
ctcagtgtggccattatgttgaccgcggccagcgtgccggcagcgaacgctgcgctcaac
agcgcgcagattgtcgcgagtgccgtgtcgcaggcctgcatcagctggcgtgtcagtggc
atttgttattggctgctgtgcacgccgtttggctgcaaggtgcggacctccgtcaaagtc
acccactatatcccggaagccgtggtgtcagcgtacaacacccagggaggcaatccctgg
cgtgaaatgtcgatggtgagtcaggctgccggcgggctggaaagcagtatcaccagcggg
ctgagtggcgtgtctgccggcggtgggaacaacgagctgaaaacccccggggaacgtaaa
accaacctccacttcaagtatgccgatgccattggtcatccggcaacgtccctgattggc
ggcagcattgccggctattcgtgccgcagcgcggcgaccccctttgtgccgtatttcctc
agcacgctggacagcctggcgtggcgtaccggtattcccgagtccctctacccggaggcg
ttggttccggggatgcgtgaggttggcagtcaggcggccgcgaatatgtggggcaacgtc
tatccccgctcggggtttgtgacccaggtcgatgacgacaaggccggtgccctggtggcg
cagcgggtggcggacatcatcacccgttctggtcaaccccacgtctatcaactcctgatg
ggccagcgctctgaggggtactggcctccaggcgctgtgacggagaacaccggtaccaac
aaccacaagtggcaacgtctggcgccgcagctcagccagtcttgcgccgtgttcccggac
ggcgaccatccgccggcagcggatgcgaacgctgcctttgccctgtggcaaccctacagc
tgctgccagcgccgcgggcagcgtttcctctccagcacggacttttga

DBGET integrated database retrieval system