KEGG   Serratia plymuthica AS9: SerAS9_2760Help
Entry
SerAS9_2760       CDS       T01503                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_2760
Enzymes [BR:srr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SerAS9_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEF45881
LinkDB All DBs
Position
2960004..2960879
Genome map
AA seq 291 aa AA seqDB search
MNEKIFTLPVTEQISPYISQRQLEELPVVVVSHPKVRAAVALQGAHLLAWQPAGDKPVIW
LSNNTPFKKGSAIRGGVPICWPWFGPVAQPSHGFARNQPWSLTAHDEDDNGVILTFTLKD
NEQTRKLWPHAFTLIARFKLGEECEIELESHGDYQATAALHTYFQIGDIEQVKVAGLGEP
YIDKVAGGAEARQTGDLAFVGQTDRVYTQPDTFSLIKDPSLQRTIEVHHHHMSDVIAWNP
GVELSCSMADMANDGYKTMVCVETGRVSKPLVAAGEQPARLAVTFRSRKKV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaattttcaccctgcccgttaccgaacaaatttcaccttacatcagtcaa
cgtcaactcgaagaactgccggtcgtggtcgtttcccacccgaaagttcgcgccgctgtt
gcgctgcaaggcgcacacctgctggcctggcaacctgccggtgataagccggttatctgg
ctgagcaacaacaccccctttaaaaaaggcagcgccattcgcggcggcgtgcctatttgc
tggccctggtttggcccggtagcacaaccctcgcacggtttcgcccgcaatcagccctgg
agcctgaccgcgcacgatgaagacgacaacggtgtcattctgacctttaccctgaaagac
aatgagcaaacccgcaagctgtggccgcatgcctttacgctgattgcccgtttcaaactg
ggtgaagaatgcgagattgagctggagtcacacggcgactatcaggctaccgcagcgctg
catacttatttccagattggggatattgaacaagtaaaagtggcgggcctcggcgaacct
tatatcgacaaagtggccggtggagcagaagctcgccagaccggggacctggcatttgtt
ggtcaaaccgatcgggtttatacccaaccggacactttcagcctgatcaaagatccttca
ctgcaacgcaccattgaggttcatcaccatcatatgagcgatgtgattgcctggaacccg
ggcgtggagctgtcctgcagcatggcagacatggcgaatgacggttataaaaccatggtt
tgcgtggaaaccggccgtgtcagtaaaccgctggtggccgcaggcgaacaaccagcccgg
ctggcggtaaccttccgcagccgtaaaaaggtttga

DBGET integrated database retrieval system