KEGG   Serratia plymuthica AS9: SerAS9_4296Help
Entry
SerAS9_4296       CDS       T01503                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS9_4296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srr02000]
    SerAS9_4296
Enzymes [BR:srr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SerAS9_4296
Transporters [BR:srr02000]
 Other Transporters
  Pores ion channels [TC:1]
   SerAS9_4296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AEF47390
LinkDB All DBs
Position
complement(4626619..4627251)
Genome map
AA seq 210 aa AA seqDB search
MSFPLTLYYCPGHLSFAPHVLLNEIGQPFELQCVSIKDGETRQLAFRELNPKGKVPVLAT
PHGILTEASAILVWLALTWPECRLLPATPFERAQAIEWLNWLSSMMPASIALRLHPHRVT
DEENAWQGIRRHGLRECEQLYQQIENRLRDKTWAVGGAFSIVDPAVMIFFRWGTLLGLDM
SQFPHWRQHTDNMLRRPAVLTTLSTEQIAF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcccattaactctttactactgtcccggtcatctctcttttgcaccccatgtg
ctcctcaatgagatcggccagccttttgaactgcagtgcgtatcaataaaagacggtgag
acacgacaactcgcttttcgtgagctgaatcccaaaggcaaagtcccggtcctggcgaca
ccgcatgggatcctgaccgaggcctcggcgattcttgtgtggctggcgctaacctggccg
gaatgtcgtttactgcctgctacgccgtttgaacgcgcacaggccatagagtggcttaac
tggctaagcagcatgatgcctgccagcattgctctgcgtctgcatccgcatcgcgttacc
gacgaagaaaatgcctggcaggggatccgccggcacggcttgcgagaatgtgaacaactg
tatcaacagattgaaaacaggctacgagataaaacctgggccgtgggtggcgcattttcg
attgtcgatccggctgtgatgatttttttccgttgggggacattgctggggctggatatg
agccaattccctcactggcggcagcatacagacaatatgctgagacgaccggcagtacta
acaacgttgtccacggagcagattgcattctga

DBGET integrated database retrieval system