KEGG   Serratia plymuthica AS9: SerAS9_4697Help
Entry
SerAS9_4697       CDS       T01503                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01130  Biosynthesis of antibiotics
srr01230  Biosynthesis of amino acids
Module
srr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SerAS9_4697
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SerAS9_4697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 Ploopntkinase3 AAA_17 AAA_24 RNA_helicase AAA_28 AAA_PrkA His_biosynth AAA_29 RsgA_GTPase AAA_14 MMR_HSR1 Mg_chelatase IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AEF47791
LinkDB All DBs
Position
complement(5064584..5065105)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDSPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcagttagctcagcaactcaatatggagttcttcgactctgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtattcgacgtggaaggtgaagaaggtttccgc
gatcgtgaagaaaaagtcattaatgaactgacggaaaagcaagggattgtgctggctacc
ggcggtggttcggttaaatcgcgtgaaacgcgtaaccgtctgtcggcgcgtggtgtcgtg
gtttatttggaaaccactatcgagaagcagttggcccgcactcagcgcgacaaaaagcgt
ccgttgctgcaggttgattctcctccgcgcgaagtgctggaagcgttggcgaaagagcgc
aatccgttatacgaagaaattgcagatgtcaccatccgcaccgacgatcaaagcgctaaa
gtggttgccaaccagattatcaatatgctggaaagcaactga

DBGET integrated database retrieval system