KEGG   Serratia sp. AS12: SerAS12_1336Help
Entry
SerAS12_1336      CDS       T01502                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
srs  Serratia sp. AS12
Pathway
srs00473  D-Alanine metabolism
srs00550  Peptidoglycan biosynthesis
srs01100  Metabolic pathways
srs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SerAS12_1336
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SerAS12_1336
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SerAS12_1336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srs01011]
    SerAS12_1336
Enzymes [BR:srs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SerAS12_1336
Peptidoglycan biosynthesis and degradation proteins [BR:srs01011]
 Precursor biosynthesis
  Amino acid ligase
   SerAS12_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AEF49426
LinkDB All DBs
Position
1456550..1457653
Genome map
AA seq 367 aa AA seqDB search
MTKLRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVTLLGIDKQGQWHINDASNYLLN
AENPALIALNRSNKNVALIPGQEKQQLIEASSAGALGQLDVVFPIVHGTLGEDGSLQGLL
RMANMPFVGAGVLGSAVSMDKDVTKRLLRDAGLAVAPFVTLTRTNRSKYGFEQLSERLGL
PLFIKPANQGSSVGVSKVQDRAGFDAALALAFSFDHKVLVESAIVGREIECAVLGNDEPQ
ASLCGEIVLSDAFYSYDTKYINEQGAKVVVPAEIAPEVSDKIRDVALKAFRALECFGLAR
VDVFLTPDNNVVINEINTLPGFTNISMYPKLWAASGVSYSELITRLIELALERHQQDRAL
NSSVFER
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaattacgggttggggtgatctttggcggtaaatcggctgagcatgaagtgtcg
ctgcagtcggcaaaaaacattgtggacgctatcgacaaagagaagtttgacgtcacgctg
ctggggatcgacaagcaggggcaatggcacattaacgatgcctccaattacctgttgaat
gcggaaaacccggcgctgatcgcgctgaaccgctcaaataaaaatgtggcgctgatcccc
ggtcaggagaaacagcaactgattgaggcgagcagcgccggcgcactgggccagctcgac
gtggtattcccgatcgtgcatggcacgctgggcgaggacggttcattgcaagggctgctg
cggatggccaatatgccgttcgtcggcgccggtgtgttgggctcggcggtgagcatggac
aaagacgtcaccaaacgcctgctgcgcgatgccgggctggcggttgccccctttgtcacc
ctgacgcgcaccaatcgcagcaaatacggtttcgagcagcttagcgagcgtttgggcctg
ccgttgtttatcaaaccggctaaccagggctcttcggtgggcgtcagcaaggtgcaggat
cgggccggctttgacgcagctctggcgctggcgttcagcttcgatcacaaggtgctggtg
gagtcggcgattgtcggccgtgagattgagtgcgcggtgttgggcaatgacgagccgcag
gccagcctgtgcggtgaaatcgtgctgagcgatgctttctactcctacgacaccaaatac
atcaatgagcagggcgcgaaggtagtggtgccggcggagatcgcaccggaagtcagcgac
aaaatccgcgacgtggcgctaaaagcgttccgggcgctggaatgctttggcctggcgcgc
gttgacgtgttcctgacgccggacaacaacgtggtgattaacgaaatcaacacgctgccg
ggcttcaccaatatcagcatgtaccccaaactgtgggccgccagcggcgtcagctacagt
gagctgattacccggttgatcgagctggcgctggagcgccatcagcaagatcgcgcgctg
aacagctcggtgttcgagcggtaa

DBGET integrated database retrieval system